Benjamí
Oller-Salvia
a,
Macarena
Sánchez-Navarro
a,
Ernest
Giralt
ab and
Meritxell
Teixidó
a
aInstitute for Research in Biomedicine (IRB Barcelona), The Barcelona Institute of Science and Technology (BIST), 08028 Barcelona, Spain. E-mail: meritxell.teixido@irbbarcelona.org; ernest.giralt@irbbarcelona.org
bDepartment of Organic Chemistry, University of Barcelona, 08028 Barcelona, Spain
First published on 18th May 2016
Brain delivery is one of the major challenges in drug development because of the high number of patients suffering from neural diseases and the low efficiency of the treatments available. Although the blood–brain barrier (BBB) prevents most drugs from reaching their targets, molecular vectors – known as BBB shuttles – offer great promise to safely overcome this formidable obstacle. In recent years, peptide shuttles have received growing attention because of their lower cost, reduced immunogenicity, and higher chemical versatility than traditional Trojan horse antibodies and other proteins.
Although many strategies to circumvent the BBB have been proposed, to date none has shown a satisfactory efficiency–safety balance. At one end of the spectrum, direct drug administration into the brain has a high risk and is very local and, at the other end, the modification of molecules to enhance their diffusion through the barrier is applicable only for some small drugs. Among the non-invasive approaches, molecular vectors – also known as BBB shuttles – (Fig. 1) have proved their potential in preclinical research over the last two decades, and some of these compounds are in clinical trials. The BBB shuttle4 concept includes Trojan horse antibodies5 and any other molecule capable of transporting a cargo into the brain parenchyma without affecting the BBB integrity. Over the last five years, research into peptide shuttles has thrived because they overcome some of the weaknesses of classical protein shuttles, including complex derivatization and characterization, high immunogenicity, and costly production. Of note, here we will use the word peptide to refer to small proteins (with or without structure) containing up to 50 amino acid residues.
![]() | ||
Fig. 1 BBB-shuttle mediated transport across the BBB. The BBB is formed mainly by the tight brain endothelium, which is surrounded by the basal lamina and regulated by the other cells in the neurovascular unit, including pericytes, glial cells and neurons.6 BBB shuttles mediate drug delivery across this barrier by taking advantage of endogenous transport pathways. Small molecules and peptides can be delivered using shuttles that undergo passive diffusion and carrier-mediated transport. However, passive diffusion is altered by the physicochemical characteristics of the cargo, including log![]() |
In this review, crossing the BBB is presented as a tremendous challenge but also as an excellent opportunity for drug delivery into the brain. We first provide an overview of BBB shuttle peptides and subsequently present the most advanced ones, which are included in drug formulations that have reached clinical trials. Then, the focus is given to three representative case studies to illustrate some of the main achievements of shuttle transport of diverse cargoes. Additionally, some strategies that rescue unspecific shuttles are reported and the relevance of protease-resistance is highlighted. Finally, we point out the main trends in the field and the challenges to be addressed.
Despite its efficient role as a barrier, the BBB is the main gateway to the brain as it grants access to necessary ions, nutrients and hormones – the maximal cell-capillary distance is 20 μm, which can be permeated by small molecules in half a second.9 Therefore, taking advantage of the endogenous transport mechanisms present on the BBB is potentially the most efficient way to deliver substances to any part of the brain.6 Many small hydrophobic compounds (<500 Da) diffuse across the endothelium membrane, while polar molecules such as glucose, amino acids, and several peptides have specific carriers; these highly selective transporters mediate transport into the endothelium cytosol and from there to the brain extracellular space. Indeed, even some macromolecules and also certain peptides cross the BBB through endocytic mechanisms involving receptor-mediated transcytosis (RMT) and/or adsorptive-mediated transcytosis (AMT). In the process of transcytosis, the vesicle formed circulates across the cell, bypassing the degradation pathway, and eventually releases its content into the parenchyma by exocytosis. AMT is considered non-specific and comprises all vesicular transport mechanisms that do not involve protein receptors; in AMT, endocytosis is generally promoted by the interaction of the often positively charged molecule with membrane phospholipids and the glycocalyx.
Temporal disruption of the tight junctions of brain endothelium by chemical or physical stimuli entails toxicity and the risk of neuronal dysfunction.14 Hence, much effort has been channelled into improving transport across endothelial cells. The most common strategies rely on enhancing lipophilicity and positive charge, in order to increase passive diffusion and mediate interaction with the anionic glycocalyx, respectively. However, these modifications lead to higher unspecific uptake in many tissues often resulting in off-target effects and, in addition, they enhance recognition by efflux pumps.12,15 A more selective way to boost the permeation of certain small molecules into the brain is to modify them by mimicking endogenous substrates of BBB carriers.16 However, all these approaches require a high degree of tailoring and are rarely applicable to large drugs such as biotherapeutics.
A more general approach for drug delivery to the CNS focuses on delivery vectors. Although biological vectors such as viruses17,18 and modified cells19 have been used to increase BBB transport, their safety, permeability across an intact barrier, and brain selectivity are still limited.18–20 Conversely, molecular vectors, dubbed BBB shuttles,4,21–33 aim to provide broadly applicable, selective and safer delivery systems.
The BBB shuttle concept was conceived by William M. Pardridge in the mid-1980s,34 inspired by chimeric proteins targeting cell receptors. The first successful attempts relied first on cationized albumin,35 which lacked brain selectivity, and then on IgGs directed against insulin and transferrin receptors.36 However, the success of these initial antibodies was limited by their high affinity, which hampered an efficient release into the brain parenchyma.15,37 Therefore, a variety of protein shuttles have been investigated; most of them are ligands of receptors on the brain endothelium and include the following: apolipoproteins (Apo) A and E,38 receptor-associated protein (RAP),39 transferrin (Tf),40 lactotransferrin,41 melanotransferrin (p97),42 and leptin.43 However, these proteins compete with their endogenous counterparts. Although a few non-endogenous proteins, such as wheat germ agglutinin44 and a non-toxic mutant of diphtheria toxin (CRM197),45 have been used, they also have shown moderate efficacy and selectivity. In recent years, research on antibodies has been relaunched focussing on lower-affinity IgG derivatives.21,37,46,47
Despite the relative success of antibodies and other large proteins, their production is expensive and high immunogenicity is an issue. This is why research in this field in the last decade has focussed to a great extent on peptides. These molecules combine the low cost of small drugs with the high specificity of biologics.37,48 Peptides are easier to obtain and characterize than the latter and have very low immunogenicity, especially those without a rigid structure.49 Moreover, they display medium to low affinities, a property that has been critical to the development of anti-TfR shuttles.37 In addition, peptides are amenable to chemical synthesis. This feature opens up the possibility of applying a wide range of non-natural modifications and of introducing a plethora of functional groups for site-specific conjugation to proteins and nanocarriers. Furthermore, reduced functional alteration of the cargo and enhanced shelf-life are also important advantages over most proteins. Although peptides have often been undervalued in pharmaceutical chemistry because of their low resistance to proteolytic degradation, this limitation can now be overcome by means of various strategies that will be described in section 7.50
Although some peptides had long been shown to cross the BBB,51 the field of peptide shuttles was pioneered in 1999 by Stephen Dowdy and coworkers.52 In this seminal paper, the authors demonstrated the capacity of a fragment from the HIV TAT protein to deliver β-galactosidase into the brain and other organs. However, it was in 2007 with RVG2953 that a peptide was proven capable of transporting cargoes into the brain in a selective fashion. Soon after, the great potential of Angiopep-254 and glutathione (GSH)55,56 as BBB shuttles was unravelled – formulations including these peptides are currently in clinical trials. Remarkably, in the last 5 years over 30 BBB shuttle peptides with increasing efficiency and versatility have been reported (Table 1).
Peptide | Typical sequence | Proposed transporter | Origin | Main cargoes | BBB passage evidence | Ref. |
---|---|---|---|---|---|---|
“BBB passage evidence” includes the main strategies used to assess the presence of the compound targeted by the BBB-shuttle in the brain parenchyma or the effects derived from it – these approaches do not provide information about brain selectivity and do not prove that the whole cargo-shuttle construct crosses the BBB. Abbreviations: Endog.: endogenous; Exog.: exogenous; nanopart.: nanoparticles; BBBCM: a cell-based BBB model; MPS: mucopolysaccharidosis; MLD: metachromatic leukodystrophy; AD: Alzheimer's disease. Nomenclature for cyclic peptides (&) is adapted to the 3-letter amino acid code from the one described by Spengler et al.188 [Dap] stands for diaminopropionic acid. Only selected references relevant to the study of these peptides as BBB-shuttles are cited here. | ||||||
Angiopep-2 | TFFYGGSRGKRNNFKTEEY-OH | LRP1 | Neurotropic endog. Protein | Small drugs, proteins, nanopart., and DNA/RNA |
• BBBCM
• Capillary depletion • Fluorescence microscopy • TEM • Effect on glioma, epilepsy and Parkinson's mouse models |
54 and 113–135 |
ApoB (3371–3409) | SSVIDALQYKLEGTTRLTRK-RGLKLATALSLSNKFVEGS |
LRP2
LDLR |
Neurotropic endog. Protein | Proteins |
• Capillary depletion
• Effect on MPS mouse model |
81 and 156 |
ApoE (159–167)2 | (LRKLRKRLL)2 |
LRP1
LRP2 LDLR |
Neurotropic endog. protein | Proteins and nanopart. |
• BBBCM
• Capillary depletion • Fluorescence microscopy • Effect on the MLD mouse model |
82, 157 and 160 |
Peptide-22 | Ac-C(&)MPRLRGC(&)-NH2 | LDLR | Phage display (receptor) | Nanopart. |
• BBBCM
• Live fluorescence microscopy |
27 |
THR | THRPPMWSPVWP-NH2 | TfR1 | Phage display (cells) | RNA and nanopart. |
• BBBCM
• TEM |
88 and 183 |
THR retro-enantio | pwvpswmpprht-NH2 | TfR1 | Phage display-derived | Small drugs and nanopart. |
• BBBCM
• Live fluorescence microscopy |
182 |
CRT | C(&)RTIGPSVC(&) | TfR1 | Phage display (mice) | Virus | • Capillary depletion | 89 |
Leptin30 | YQQILTSMPSRNVIQISND-LENLRDLLHVL | Leptin receptors | Neurotropic endog. protein | DNA | • Capillary depletion | 76 and 77 |
RVG29 | YTIWMPENPRPGTPCDIFT-NSRGKRASNG-OH | nAchR | Neurotropic exog. protein | Nanopart. and RNA/DNA |
• Capillary depletion
• BBBCM • Effect in viral encephalitis and mouse models of Parkinson's disease |
53 and 146–154 |
DCDX | GreirtGraerwsekf-OH | nAchR | Neurotoxin-derived | Nanopart. |
• BBBCM
• Effect on glioblastoma |
94 |
Apamin | C(&1)NC(&2)KAPETALC(&1)-AR-RC(&2)QQH-NH2 | KCa channel? | Neurotoxin | Proteins and nanopart. | • BBBCM | 95 and 96 |
MiniAp-4 | [Dap](&)KAPETALD(&) | KCa channel? | Neurotoxin-derived | Small drugs, proteins and nanopart. |
• Human BBBCM
• Fluorescence microscopy |
97 |
GSH | γ-L-glutamyl-CG-OH | GSH transporter | Endog. peptide | Nanopart. |
• Intracerebral microdialysis
• Effect on glioma and MS mouse models |
55, 56 and 141–145 |
G23 | HLNILSTLWKYRC | GM1 | Phage display (receptor) | Nanopart. |
• BBBCM
• Fluorescence microscopy |
107 |
g7 | GFtGFLS(O-β-Glc)-NH2 | Unknown receptor | Endog. peptide-derived | Nanopart. |
• Fluorescence microscopy
• TEM |
100 and 164–166 |
TGN | TGNYKALHPHNG | Unknown receptor | Phage display (in vivo) | Nanopart. |
• Fluorescence microscopy
• Effect on glioma and AD mouse models |
109–111 |
TAT (47–57) | YGRKKRRQRRR-NH2 | AMT | Exog. protein | Proteins and nanopart. |
• BBBCM
• Capillary depletion • Fluorescence microscopy • TEM |
52 and 167–174 |
SynB1 | RGGRLSYSRRRFSTSTGR | AMT | Toxin | Small drugs |
• Brain perfusion
• Capillary depletion |
62 and 63 |
Diketopiperazines | &(N-MePhe)–(N-MePhe)Diketo-piperazines | Passive diffusion | Design (+serendipity) | Small drugs |
• PAMPA
• BBBCM |
32 and 180 |
PhPro | (Phenylproline)4-NH2 | Passive diffusion | Design | Small drug | • PAMPA | 68 |
For small drugs (<300 Da), peptide shuttles formed by 2–4 amino acid residues that cross the BBB through passive diffusion are more attractive since they may minimize the loss of activity upon conjugation. In peptides diffusing across the BBB, hydrogen bonding and water desolvation have a better correlation with permeability than logP.67 Based on this criterion, three families of BBB shuttle peptides, namely diketopiperazines,32N-methylphenylalanines29–31 and phenylprolines,68 have been developed.
![]() | ||
Fig. 2 Sources of BBB shuttle peptides. (a) Phage display biopanning may be performed on isolated receptors, cells overexpressing a particular receptor or in vivo. The phages that bind the receptors or accumulate in the brain are recovered, amplified through bacterial infection, titrated and sequenced. The biopanning cycle is generally repeated 2–3 times and the most abundant sequences are chemically synthesized for further study. (b) For peptides coming from (neurotropic) proteins, the moiety responsible for transport is identified through one or more of the following techniques: sequence alignment, screening of synthesized fragments or structural studies involving X-ray and NMR. Here we highlight a sequence of ApoE (PDB: 1LPE) that has been shown to interact with LRP1 (PDB: 2KNY).187 (c) Passive diffusion shuttles have been designed taking into account the parameters involved in this permeation mechanism. The structure of phenylproline is presented here as the BBB peptide shuttle with the highest solubility and transport capacity. |
Ideally, BBB shuttles should target receptors with the following attributes: high expression in the luminal side of brain vasculature with respect to other tissues; capacity to mediate transcytosis; high turnover and broad substrate recognition.72 Moreover, the physiological role of the transporter should not be easily altered. Unfortunately, quantitative physiological information of the wide variety of brain endothelium receptors reported is very limited, thus screening together with trial and error rather than design has mainly driven the discovery of new shuttle peptides. Of note, although many sequences have been reported to target a particular receptor, the contribution of other mechanisms cannot be excluded.15 Determining whether the molecule has reached the brain parenchyma is already a challenge and studying the delivery route requires a multifocal and integrated approach (Table 2).
Model | Advantages | Limitations | Observations & examples | Ref. |
---|---|---|---|---|
Despite the plethora of BBB models currently available,189–192 evaluating the capacity of BBB shuttles to deliver a cargo across the BBB into the brain parenchyma remains challenging. Thus, an integrated approach is required. Cell-based BBB models193 have often been applied to screen BBB shuttles mainly due to their balance between high-throughput and predictive values. Moreover, these models allow focusing on transcellular transport without any interference of other physiological factors, which is particularly useful in mechanistic studies provided paracellular diffusion is low enough; direct internalization assays can also deliver valuable information in this regard. In particular, experiments with human endothelial cells are essential to complement transport studies in animals. Notwithstanding, further refinement and validation of transporters in cell-based BBB models would boost their use. Regarding in vivo studies, the capacity of the best-validated shuttles has been evaluated in healthy mice and in animal models of disease. In situ brain perfusion in tandem with microdialysis of the brain interstitial fluid provides the most reliable quantification of the unbound drug capable of crossing the BBB. However, these techniques are seldom used due to their complexity, low throughput and limitations of probes for large cargoes. Conversely, a capillary depletion step is more common to minimize to a certain extent the quantification of the compound adsorbed onto or internalized in brain endothelium. This method, which tends to overestimate the parenchymal concentration,194 is often complemented with an image showing the construct outside the capillaries. Since it is difficult to unambiguously assign spots or a background increase in fluorescence, establishing co-localization with a localized target (e.g. amyloid plaques) is more reliable. Additionally, some studies take advantage of an intrinsic property of the cargo to show that it remains functional upon reaching the brain parenchyma and that a label or a metabolite is not quantified instead. The use of BBB integrity markers and controls including scrambled peptides gives further strength to these studies. Finally, an increase in the therapeutic effect of a drug in an animal model can also be an indirect proof that the drug-shuttle conjugate has reached the brain parenchyma providing the target is only in the CNS and the BBB is intact. | ||||
Passive diffusion BBB models | • Suitable for high-throughput screening |
• Only useful for compounds that cross mainly through diffusion
• Cannot predict the effect of efflux pumps |
• E.g. diketopiperazine, N-methyl-Phe and phenylproline shuttles have been optimized using the parallel artificial membrane permeability assay (PAMPA) | 29–32, 68 and 180 |
Cell uptake |
• High throughput
• Mechanistic understanding of the transport process using simple settings: active transport (temperature, sodium azide), endocytic mechanism (saturation, inhibition), and receptor type (competence with substrates) |
• Cannot be used to predict BBB permeability
• Expression of transporters may differ from physiological human BBB • Inhibitors may affect different pathways in diverse cell-lines • No evidence of whether the construct has been degraded |
• Immortalized cell-lines are preferred to primary endothelial cells since the lattter rapidly lose their natural phenotype; bEnd3 is the most used cell-line
• E.g. mechanisms of Angiopep-2 and TGN have been partly elucidated through cell uptake |
25, 109, 113 and 132 |
Cell-based BBB models |
• Good correlation with in vivo permeability values of small molecules
• Compromise between costs, throughput and predictive value • Paracellular transport restricted by tight junction proteins • Functional expression of many transporters • Can be used to study transport mechanisms when paracellular contribution is low |
• Difficult to compare permeability values between different models
• Only certain trends and certain permeability values can be predicted for macromolecules & NPs • Trans-endothelial resistance is still low in robust models compared to in vivo (0.05–1 vs. >2–8 kΩ cm2) • To minimize paracellular contribution some authors perform pulse-chase assays • Expression of transporters may differ from physiologic human BBB • High cost of Transwell® and media |
• Various cell alternatives: non-cerebral cells or brain capillary endothelial cells (BCEC). BCEC can be from different species and primary or immortalized, generally in co-culture with glial cells or pericytes. hCMEC/D3 is the most used cell-line, although it is considered leaky
• E.g. Angiopep-2, THRre and MiniAp-4 were discovered in a bovine BBB cell-based model |
21, 54, 82, 94, 95, 97, 135, 160, 182 and 183 |
In vivo intracerebral microdialysis |
• Measures unbound drug in the interstitial fluid site-specifically with a putatively intact BBB
• Fast sampling and possibility to measure during extended periods (days) • Current probes preclude sampling large constructs such as nanopart. |
• Very low throughput
• Requires highly skilled personnel • Tissue damage and glial activation produced by the probe • Interaction with receptors cannot always be extrapolated to humans (like all techniques applied to animals/tissues derived from them) |
• E.g. drugs carried by PEGylated liposomes targeted with GSH have been measured using microdialysis | 98 and 144 |
In vivo non-invasive imaging |
• General: rough assessment of PK with a limited number of animals
• Fluorescence and luminescence are available without restrictions and are the fastest noninvasive methods (<1 min vs. rest >30 min); wide choice of fluorescent labels; luminescence is more sensitive • PET and SPECT: high sensitivity and penetration • MRI: high penetration and resolution (0.1–1 mm); no regulatory restrictions |
• General: lower resolution than ex vivo (generally >1 mm); no possibility to verify the integrity of the construct
• Fluorescence and luminescence: low-penetrating and semi-quantitative • PET and SPECT: regulatory restrictions for radioactivity; PET requires short-lived radiotracers and cyclotron • MRI: difficult to quantify |
• Fluorescence: most widely used
• Luminescence: luciferase gene delivery • PET: herpes simple virus thymidine kinase (e.g. CRT) • SPECT: 125I-labelled proteins (e.g. 9Lys-ApoE (151–170)) • MRI: iron oxide NPs and DTPA or DOTA–Ga3+ (e.g. Angiopep-2, cRGD) |
23, 89, 92, 93, 97, 126–134, 136, 154 and 161 |
In vivo two-photon microscopy |
• High resolution (<10 μm)
• Only technique that provides live visual evidence of BBB permeation |
• Need for craniotomy
• Low throughput; requires skilled personnel |
• Quantum dots targeted with THR retro-enantio | 27 and 182 |
Ex vivo quantification of entire organs |
• General: removal of blood and external tissues; minimal alteration of the sample
• Fluorescence: no special regulation, only the organs of same type can be compared (e.g. the amount of BBB-shuttle-cargo vs. cargo in brain) • High-energy radiotracers: accurate measure of the total amount of constructs; autoradiography of brain slices provides low-resolution brain distribution |
• General: requires the use of labels and does not allow the identification of the entities
• Fluorescence: semi-quantitative → only the same organ in different animals can be compared • High-energy radiotracers: specific regulations |
• Fluorescence is the most extensively used
• 125I and 131I have also been used to label BBB shuttle constructs, especially with Angiopep-2 |
23, 111, 126, 127, 132 and 134 |
Ex vivo quantification in organ homogenates |
• Capillary depletion allows measurement of the amount of compound in brain parenchyma
• Identity of the compound can be verified • If extraction is quantitative, most techniques provide absolute amounts that can be compared between different organs • A wide variety of quantification techniques can be applied |
• Capillary depletion is not quantitative and results should be interpreted with great care
• Many steps before the final measure increase the chances of introducing artefacts |
• 3H and 14C have been used to label drugs encapsulated in GSH-coated PEGylated liposomes and Angiopep-2 constructs
• ICP-MS is the reference technique for metal NPs (e.g. THR, Angiopep-2) • Absorbance, fluorescence and luminescence have been used to quantify delivered molecules/enzymes/genes encoding them (e.g. RVG29, RDPs) • Flow cytometry (e.g. TAT, RVG29) |
36, 37, 39, 44, 53, 54, 82, 83, 91, 111, 127, 157, 162 and 176 |
Ex vivo microscopy |
• Optical microscopy gives rough localization of the cargo (i.e. enzyme)
• TEM is the most reliable, sensitive and precise technique for metal nanoparticles • Fluorescence microscopy can reveal the real position of cargo (staining the capillaries or colocalization with certain cell types, such as neurons) |
• Fixation efficiency of the constructs may be different
• Processing of the sample may introduce artefacts • Punctuated or diffuse patterns without a clear localization may be difficult to distinguish from noise |
• Optical microscopy: β-galactosidase (e.g. TAT and RDPs)
• TEM (e.g. THR) • Fluorescence microscopy (e.g. ApoB and ApoE peptides, g7) |
21, 44, 45, 81, 82, 161 and 183 |
The receptors with high expression on the BBB for which transcytosis has been best characterized include: transferrin (TfR1),40 low-density lipoproteins (LDLRs),73 insulin74 and leptin.75 However, while the first two have been widely used for brain delivery, very few BBB shuttle peptides derive from the others.76,77
LDLRs have been extensively studied for their roles in transport and signalling78 and they are the most exploited receptors for delivery across the BBB using peptides. Moreover, some of them (particularly LRP1) are overexpressed in the brain79 and in tumours.80 Peptides targeting this family of receptors either are based on natural protein ligands, namely ApoB and ApoE fragments81,82 and Angiopep-2, or they are found by phage display biopanning against LDLR, like Peptide-22.27
TfR1 is also well characterized among BBB transport receptors. Furthermore, it has even higher expression than LRP1 on the brain endothelium83–85 and is widely present in tumours.86 Peptides interacting with TfR1 were discovered by applying phage display biopanning in various ways. B6 was identified in a nonamer library screened against the extracellular domain of human TfR,87 whereas THR and T7 were found through panning against a human receptor expressed in chicken fibroblasts (chicken TfR does not bind human Tf),88 and the CRT peptide was found to selectively target mouse brain parenchyma in vivo.89
In addition to the aforementioned receptors, many other pathways have been explored in an attempt to increase brain delivery efficiency and selectivity. The widespread occurrence of some ion channels in the CNS, as well as their intracellular traffic and recycling ability, have inspired several shuttles, comprising RVG29, RDPs,90,91 KC2S,92LCDX,93DCDX,94 apamin,95,96 and MiniAp-4.97 By contrast, the endogenous peptide GSH was identified as a BBB shuttle following from its reported capacity to reach the brain through a saturable and specific mechanism. Many transporters, some of which are preferentially expressed in the CNS,98 mediate the influx and efflux of GSH and its endogenous conjugates;99 however, further research is required to elucidate the putative transcytotic mechanism of GSH. Another shuttle derived from an endogenous peptide is g7,100 which is discussed later in this review.
Although integrin receptors do not display a particularly high expression in the brain microvasculature, they have been extensively used for targeting brain tumours and inflamed regions of the CNS.101 Cyclic RGD (cRGD)102 is a peptide derived from a sequence present in many proteins that recognise these receptors. Because integrin αvβ3 is overexpressed in the neovasculature, cRGD has been extensively used to target nanoparticles into gliomas.103 However, it can mediate transcytosis only indirectly through internalization into leukocytes and other immune cells, which are recruited into the brain in response to inflammation.19
Protein transporters are not the sole means to achieve a certain degree of selectivity in the transcytosis across brain endothelium. Gangliosides have a heterogeneous tissue distribution and can also mediate transport across polarized cells.104,105 This particular selective AMT mechanism has been exploited by G23 peptide, which was found by phage display biopanning against gangliosides GT1b106 and GM1,107 the latter of which is present in caveolae. G23 has been shown to promote the transport of nanoparticles across the BBB107 and provide a targeting effect.108
Finally, several peptide shuttles have been found through in vivo phage display biopanning without aiming for a particular receptor. The most prominent example is that of TGN.109 This sequence is actively transported across brain endothelial cells and its brain selectivity suggests that the mechanism is receptor-mediated. The brain delivery capacity of this shuttle is supported by enhanced therapeutic effect in glioblastoma and Alzheimer's mouse models.110,111
![]() | ||
Fig. 3 Angiopep-2 discovery and validation as a BBB shuttle. Angiopep-2 was discovered by alignment of Kunitz protein domains followed by a screening of 96 analogues in a bovine cell-based blood–brain barrier model. The transport of the selected peptide was inhibited by low temperature, RAP protein, and α2-macroglobulin, thereby indicating that the transcytosis was active and probably mediated by LRP-1.113 However, several uptake mechanisms may contribute to the transport of conjugates.25 This peptide has proven its efficiency as a BBB shuttle in vitro and in vivo. Whole-animal fluorescence imaging and autoradiography among other techniques have shown that Angiopep-2 constructs accumulate in the brain. Additionally, there is qualitative (e.g. microscopy. Image reproduced with permission from ref. 195. Copyright 2010 Elsevier) as well as quantitative (e.g. radioisotopic labelling and capillary depletion) evidence proving that this peptide reaches the brain parenchyma. Angiopep-2 conjugated to paclitaxel is currently in Phase II clinical trials. |
Angiopep-2 has been used to transport a wide variety of nanocarriers loaded with small molecules, proteins or genetic material into the CNS. These carriers include liposomes,122,123 nanotubes,124 dendrimers made of polyamidoamine125–128 and poly-L-lysine,129 and also nanoparticles made of PEG–polycaprolactam,130–133 PEG–poly(lactic-co-glycolate) (PEG–PLGA),134 thermoresponsive hydrogels,135 upconversion nanocrystals136 and gold.137 The diameter of these particles ranged from 7 to 200 nm thus further confirming the versatility of this shuttle. Moreover, the number of peptides required for efficient delivery is relatively low; four peptides are considered optimal for 7–8 nm dendrons127 and 53 peptides on the surface of a 90 nm nanoparticle provided efficient transport.25 The increase in brain delivery for most constructs is in the range of 1.5- to 3-fold in mice.
The vast majority of studies with Angiopep-2 describe about conjugates for the diagnosis125,136 or the treatment124,131,137 of brain tumours; in the second case a significant increase in survival with respect to the free drug or untargeted nanocarriers has often been reported. Although this peptide has been used mainly to transport small molecules and nanoparticles, conjugation of the shuttle to trastuzumab has recently been shown to enhance the therapeutic effect of this antibody in mice bearing HER2+ brain tumours.138 Angiopep-2 also increases the antifungal activity of amphotericin B in meningoencephalitis139,140 and the therapeutic index of phenytoin sodium against epilepsy in rats.135 Additionally, delivery of Angiopep-2-coated nanoparticles loaded with hGDNF boosts the neuroprotective effect of this protein in a Parkinsonian rat model, improving the locomotor activity and recovery of dopaminergic neurons.129 Although in some of these models, especially in those involving tumours, the BBB may be compromised, permeation has also been assessed in healthy mice and cell-based BBB models.135
G-Technology® for doxorubicin delivery (2B3-101) has reached Phase I/IIa clinical trials for brain cancer treatment (http://ClinicalTrials.gov identifier: NCT01386580). This nanoplatform has also been exploited for the delivery of methylprednisolone (2B3-201), enhancing its transport up to 6.5-fold.142 2B3-201 is capable of reducing neuroinflammation in rats with encephalomyelitis, and reached Phase I clinical trials for multiple sclerosis55 (http://ClinicalTrials.gov identifier: NCT02048358). Even more remarkable is the selective increase in brain delivery of single domain antibodies against amyloid plaques in APP/PS1 mice.145
The high potential of this sequence for gene delivery has been confirmed using either the oligoarginine tail,147,148 a polylysine dendrigraft,149 polyethylenimine,150,151 polyasparthydrazide151 or polyamidoamide dendrimers152 to bind the oligonucleotide chains. RVG29 linked to exosomes is particularly efficient as it mediates higher protein knockdown than when linked to oligoarginine with five-fold less RNA.153 As an example of therapeutic effect, the polylysine dendrigraft targeted delivery of caspase-3 RNAi reduced caspase-3 levels, improving locomotor activity and rescuing dopaminergic neuronal loss in a rat model of Parkinson's disease.154
Apolipoprotein B100 (ApoB) is the primary component of low-density lipoprotein and it interacts with LDLR and LRP2.79 Spencer and Verma81 achieved hepatic expression of proteins in the liver fused to the binding domain of ApoB (3371–3409, P04114 UniProt), which resulted in sustained brain delivery. The cDNA was introduced into the liver and spleen using a lentivirus vector. Through this strategy, GFP and glucocerebrosidase were delivered into the brain. Fluorescence microscopy revealed the co-localization of these molecules in neurons and astrocytes in the regions of the brain with a high expression of LDLR. Also using ApoB (3371–3409) to target iduronate-2-sulphatase, the overall brain pathology was improved in a mouse model of mucopolysaccharidosis type IIIA.156
Despite the successful cases of ApoB BBB shuttles, peptides derived from ApoE showed higher efficiency when applied to transport other proteins.82,157 This observation may be related to ApoE binding a variety of LDLRs, including LRP1.79 Of note, altering the homeostasis of this protein entails many secondary effects,9 which could be minimized using only the moiety involved in transport. With the aim of finding the most suitable fragment of ApoE, several sequences reported to interact with LDLRs158,159 were compared.82 In this comprehensive study, ApoE fragments were expressed as a fusion protein with a lysosomal enzyme (IDUA) in the liver in order to target this enzyme to the brain (Fig. 4).
![]() | ||
Fig. 4 Brain delivery of IDUA–ApoE (159–167)2 expressed in the liver. Increased delivery of IDUA into the mouse brain parenchyma was achieved by expressing it as a fusion protein with ApoE (159–167)2 in mouse liver.82 The fusion of ApoE peptide increased 3.6-fold the transport of IDUA in a pulse-chase assay performed on a cell-based BBB model – in this experiment the protein is incubated and, after washing, the transport of the protein adsorbed onto or internalized by endothelial cells is measured; this strategy intends to minimize the paracellular contribution to the transport, which is still a concern in cell-based BBB models.21 Remarkably, the amount of IDUA found in the brain when expressed in mice livers fused to ApoE (159–167)2 was 20-fold higher than when expressed without the BBB shuttle. Quantification was performed after capillary-depletion. In addition, these authors provided fluorescence microscopy images, which indicate colocalization of the construct with neurons and astrocytes and show a clear pattern of diffusion from the capillary into the parenchyma. With this approach, 23% of normal brain IDUA activity was restored, which was sufficient to decrease brain glycosaminoglycan and β-hexosaminidase concentrations to normal levels in mucopolysaccharidosis type I mice. |
One of the two peptides with the best performance found in the aforementioned study82 was the tandem dimer sequence ApoE (159–167)2 (UniProt P02649-1) which had better transport in a cell-based BBB model than the monomer.160 This peptide was also the best-ranked BBB shuttle in a very recent comparative study157 using a mouse model for another lysosomal storage disease, namely metachromic leukodystrophy. In that publication, ApoE (159–167)2 did not show the best performance in endocytosis or in a porcine BBB cell-based model; however, it was the only shuttle to increase the in vivo brain delivery of arylsulfatase A (by 54%) when compared to Angiopep-2, ApoE (148–170), and ApoB. Surprisingly, this shuttle did not compete with the endogenous protein as suggested by the lack of increased transport efficiency in ApoE-knock out mice.
It is also worth highlighting the delivery of large proteins into the brain using a physical mixture of the cargoes with ApoE (151–170) in tandem with a 16-lysine sequence.161 However, this construct has subsequently been found to prompt a transient disruption of the BBB,162 as has been observed with other highly positively charged carriers.163
Numerous in vitro and in vivo studies show that g7 is capable of delivering PEG–PLGA nanoparticles into the brain.164 The increase in brain accumulation has been assessed by whole-animal fluorescence imaging165 and also by measuring the amount of rhodamine 123 released from the nanoparticle; remarkably, 15% of the fluorophore administered intravenously was reported to reach the brain. These nanoparticles are mainly delivered to the grey matter166 and their presence in the brain parenchyma has been imaged using fluorescence and transmission electron microscopy. Further evidence of the therapeutic effect of this peptide-coated nanocarriers upon intravenous injection would certainly encourage a more widespread use.
Nonetheless, recent studies have shown that dual-targeted liposomes with either Angiopep-2–oligoarginine, T7–TAT, THR–transportan or Tf combined with TAT, penetratin or mastoparan outperformed those with a single targeting peptide, both in vitro and in vivo.131,175–177 This strategy takes advantage of the penetrating capacity of CPPs by combining it with the higher selectivity of receptor ligands. It would certainly be interesting to study the effect of the double functionalization approach with more novel, potent and less toxic CPPs such as dNP2.178
Despite the achievements described above, the applicability of BBB shuttle peptides that work through passive diffusion is still limited by the lack of selectivity and the non-negligible impact of the cargo on the efficiency of the shuttle and vice versa. On the side of the BBB transport capacity, this problem can be overcome by fine-tuning the peptide for each particular cargo.29 In order to decrease the effect of the construct on the activity of the molecule, linkers that can be cleaved inside the brain parenchyma could be incorporated.
THR is a dodecapeptide obtained by phage display that interacts with TfR but does not compete with Tf.88 This peptide shuttle enhances the in vitro and in vivo transport of gold NPs coated with a peptide (LPFFD) capable of binding amyloid-β in order to disrupt aggregates upon microwave irradiation.183 TEM micrographs confirmed the presence of NPs in the parenchyma. Remarkably, it has recently been shown that the retro-enantio version of THR (THRre) transports a variety of cargoes with higher efficiency than the parent peptide in a cell-based BBB model and in vivo.182 Moreover, THRre was capable of delivering quantum dots to the brain parenchyma as shown by two-photon intravital microscopy (Fig. 5).
![]() | ||
Fig. 5 Protease-resistance provides efficient BBB shuttle peptides. (a) Structural modifications to achieve protease-resistance that have been applied to BBB shuttle peptides. (b) The half-life of THR peptide is 30 min, whereas that of the retro-enantio version (THRre) is over 24 h.182 As a result, THRre transcytosed in a cell-based BBB model and accumulated in the brain more efficiently. Furthermore, this peptide was capable of delivering quantum dots across the BBB as shown by intracranial two-photon microscopy (bottom; capillaries are shown in green and quantum dots in red. The image is reproduced with permission from ref. 182. Copyright 2015 Wiley); this technique avoids artefacts introduced during perfusion, necropsy and tissue preparation for ex vivo microscopy imaging. (c) Cyclization of peptides also results in increased protease-resistance as illustrated in the case of apamin derivatives.97 In addition, introducing non-natural elements such as substitution of a disulfide bond by a lactam bridge to produce peptidomimetics like MiniAp-4 further reinforces metabolic stability. MiniAp-4 enhanced the transport of a variety of cargoes in mice and in a human cell-based BBB model. |
In contrast to THR, LCDX is a peptide of natural origin. This linear fragment of snake neurotoxin candotoxin, which interacts with nAchRs, was reported following the success of RVG29.93LCDX increased nanoparticle accumulation in mouse brain and enhanced the survival of tumour-bearing mice. Recently, the retro-enantio analogue has been developed and shown to retain the capacity to interact with the same receptor.94 Although the affinity of this analogue is 5-fold lower than the original peptide, its transport capacity is enhanced because of its superior resistance to proteases in serum and in the lysosome.
Apamin is a bicyclic neurotoxin that binds KCa2.2 channels, which are found in neural cells and the vasculature, and has long been known to reach the CNS.184,185 This peptide is highly resistant to proteases95 and is capable of targeting nanoparticles and proteins to the brain.96 However, high toxicity and immunogenicity, as well as a relatively complex structure, have discouraged its extended application as a shuttle. Recently, MiniAp-4, which is a safer and minimized version of apamin cyclized through a lactam bridge, has been reported.97 Importantly, this cyclic peptidomimetic preserves the high protease-resistance and brain targeting ability of apamin and has reduced toxicity and immunogenicity. MiniAp-4 is more permeable than the natural peptide and can transport nanoparticles and proteins in a human cell-based model of the BBB. Furthermore, this shuttle can carry a cargo across the BBB in mice and displays remarkable selectivity for the brain.
Despite the considerable achievements described, new shuttles with higher transport capacity and selectivity are required. Approaches like phage display and natural sources of peptides that reach the CNS offer an excellent opportunity to explore the multitude of poorly characterized or still unknown routes into the brain. These strategies should be complemented with additional efforts in the characterization of the transport mechanisms and in global proteomic approaches to identify new receptors. Also, further comparative studies between shuttles and a more accurate quantification of the free drug in the brain parenchyma would enable a more efficient identification and optimization of BBB shuttles. The next generation of BBB shuttle peptides should aim for an enhanced metabolic stability, a higher transendothelial transport and an improved selectivity for the brain – even for particular regions of this organ – possibly through yet uncharacterized transctytotic pathways.
This journal is © The Royal Society of Chemistry 2016 |