DOI:
10.1039/D6CB00093B
(Review Article)
RSC Chem. Biol., 2026, Advance Article
The inhibitors of 17β-HSD10: are they any good?
Received
12th March 2026
, Accepted 22nd May 2026
First published on 28th May 2026
Abstract
The advent of the first disease-modifying therapies for Alzheimer's disease (AD) has renewed optimism for effective prevention and treatment strategies. Growing mechanistic insights indicate that AD pathogenesis is multifactorial and non-linear, better conceptualized as a circular vortex in which interconnected pathological processes reinforce one another. This complexity highlights the necessity for multiple druggable targets and combination-based therapeutic approaches. A hallmark of AD is reduced cerebral glucose utilization, revealed by positron emission tomography studies, reflecting profound metabolic disruption and mitochondrial dysfunction. Among mitochondrial candidates, 17β-hydroxysteroid dehydrogenase type 10 (17β-HSD10), encoded by HSD17B10, has emerged as a protein of interest. Despite debate surrounding its substrate specificity due to conflicting in vitro data, its elevated expression in neurons and astrocytes within AD brains underscores its potential relevance. This review outlines chemical entities targeting both catalytic and non-catalytic functions of 17β-HSD10 and examines whether its inhibition offers biological efficacy and clarifies its metabolic roles in the living brain.
 Ernst Kwa | Ernst Kwa is a first-year PhD student under Professor Frank Gunn-Moore at the University of St Andrews. He completed his undergraduate degree in Neuroscience at the University of Dundee, undertaking a project with Dr Esther Sammler at the MRC PPU, studying LRRK2 hyperphosphorylation in Parkinson's Disease. His PhD research currently includes defining the role of 17β-HSD10-mediated metabolic dysfunction in Alzheimer's Disease and evaluating the translational potential of newly synthesised small molecular inhibitors. |
 Charlene E. Ogilvie | Dr Charlene Ogilvie is a protein biochemist specialising in metabolomics using liquid chromatography–high-resolution mass spectrometry (LC-HRMS), with extensive experience in both wet-lab experimentation and downstream dry-lab computational analyses. Her work focuses on generating high-quality metabolomics datasets, for analysis using a combination of targeted and untargeted approaches, to support the development of novel therapeutics for neurodegenerative diseases. Dr Ogilvie is the lead researcher in the Gunn-Moore lab at the University of St Andrews and is currently investigating the preclinical absorption, distribution, metabolism, and excretion (ADME) of two lead compounds for the treatment of Alzheimer's disease. |
 Natalie C. Kormos | Natalie Kormos is a graduate of the University of St Andrews, holding degrees in biology, business and a Master's by Research. The focus of her research project explored 17b-HSD10 as an enzymatic drug target for the potential treatment of Alzheimer's disease, through the screening of a library of naturally derived fungal compounds. She developed a preliminary pipeline to identify potential inhibitors, applying this method to a set of 640 compounds. She is actively involved in public outreach through the interdisciplinary integration of scientific endeavours, public engagement and advocacy for Alzheimer's disease, bridging connections between biomedical research and the wider community. |
 Alison J. E. Green | Dr Alison Green is a clinical biochemist with over 30 years of experience in developing and evaluating diagnostic tests for neurodegenerative diseases. She has a wealth of experience in both academic and NHS laboratories; many of the tests she developed have been introduced into clinical practice, notably real-time-quaking induced conversion (RT-QuIC) for diagnosis of prion diseases, Parkinson's disease and Lewy body dementia. She is currently investigating the role newly developed blood-based biomarkers for Alzheimer's disease will play in diagnostic practices. Alison Green has over 85 peer-reviewed academic papers and has held numerous grants with total cost over £2M. |
 Terry K. Smith | Prof. Terry K. Smith, trained as a synthetic chemist, has over 30 years of inter-disciplinary experience working with protozoan parasites focussing on understanding and exploiting their lipid metabolism for therapeutic opportunities. The Smith group is highly collaborative and is a truly multi-disciplinary research team, occupying biochemistry and chemistry labs, as well as CL3 facility in the Biomedical Science Research Complex, which houses a plethora of world-class facilities and collaborations in Chemistry, Biology, Physics and Medicine. Terry is currently the director of the BSRC and received a CBE for his contributions to disease research in 2024. |
 Frank J. Gunn-Moore | Frank Gunn-Moore is a Professor of Molecular Neurobiology, and his group studies the cellular and biochemical development and survival of the mammalian nervous system. His group has made major discoveries in understanding the early stages of Alzheimer's disease, pioneering new models (including the discovery that cetaceans have similar pathology) and in the process has identified potential therapeutic targets for the early stages of this disease. Using both molecular and novel biophysical techniques, his group has also discovered novel signalling pathways (including the gene Willin/FRMD6) that are involved in the growth and development of neurons and the pathogenesis of Alzheimer's disease. |
Introduction
As the first disease-modifying treatments have started to appear,1 there is renewed optimism in the development of new therapeutics for the prevention and management of Alzheimer's disease (AD). Additionally, as research continues to shape our mechanistic understanding of AD pathology,2,3 it has become clear that disease triggers are multifactorial, and not simply a linear cascade of events. Consequently, we postulate that AD is a circular vortex with several entry points, and that pathogenesis rarely stems from a singular cause. Given the complex disease aetiology, identification of multiple druggable targets is imperative for effective therapeutics. Indeed, we have previously highlighted the requirement for at least three drug types to enable the effective treatment of AD.4
Previous studies using positron emission tomography (PET) scans have revealed a substantial reduction in glucose utilisation in AD brains, despite normal levels in healthy ageing counterparts.5 This finding indicates major disruptions in core metabolic processes, with mitochondrial dysfunction evidently being a well-documented feature of AD pathology.6 While 14 different mammalian classes/types of 17-β hydroxysteroid dehydrogenase (17β-HSD) have been identified, only 12 are present in humans7,8
The focus of this review is 17-β hydroxysteroid dehydrogenase type 10 (17β-HSD10), encoded by the HSD17B10 gene.9–11 This mitochondrial enzyme has piqued longstanding interest and generated much debate, with several publications disputing proper nomenclature due to contradictory in vitro findings, leading to uncertainty over substrate specificity in vivo.12–15 Such discrepancies, however, can be attributed to wide variations in experimental parameters, which likely have little relevance to the living human brain. What is not in question, however, is that both neurons and astrocytes are involved, with each reported to have elevated 17β-HSD10 protein expression in the AD brain,12,16 although the full consequence of this has yet to be elucidated.
In the last decade, several different lines of research have suggested that modulation of 17β-HSD10 function may have therapeutic merit. Therefore, in this review, we will describe the different chemical entities that have been developed to target the catalytic and non-catalytic activities of this protein. Many of these novel compounds are now at the stage of being able to answer two critical questions:
(1) Does inhibiting 17β-HSD10 activity have biological efficacy in AD models (and possibly other diseases)?
(2) Is it now possible to determine which metabolites/substrates 17β-HSD10 modifies in the living brain?
17β-HSD10 identification and nomenclature
As outlined above, identification of the true physiological role of 17β-HSD10 has been a longstanding point of contention in the field, largely due to early studies relying upon heterologous expression of recombinant proteins in Escherichia coli, with much variation in subsequent protein purification and activity assay protocols.12,14,17–19 However, a combination of in vivo and cell culture studies in mammals, Xenopus laevis and Drosophila melanogaster has given some insights into physiologically relevant functions, highlighting clear roles in neurosteroid oxidation, mitochondrial homeostasis and branched-chain amino acid metabolism.12,19,20 For example, deletion of the 17β-HSD10 gene in mouse models resulted in embryonic demise during gastrulation,21 while a tissue-specific conditional knockout led to the development of mitochondrial abnormalities, such as the loss of cristae and fragmented organelle.21 In X. laevis models, knockdown of the 17β-HSD10 homologue reduced mitochondrial pyruvate turnover and triggered apoptosis that eliminated forebrain and eye structures.21 Conversely, rescue experiments demonstrated that microinjection of wild-type human 17β-HSD10 restored mitochondrial morphology and prevented apoptosis.21 Furthermore, loss-of-function studies investigating the D. melanogaster short chain L-3-hydrxoyacyl-CoA dehydrogenase, a 17β-HSD10 homologue encoded by the scully (scu) gene, revealed embryonic and pupal lethality, accompanied by severe defects in germline development; mutant flies also exhibited mitochondrial abnormalities in photoreceptor cells, producing phenotypes that closely resembled human β-oxidation fatty acid disorder.22 Overexpression studies have further illustrated the functional significance of 17β-HSD10.23 For example, overexpression of 17β-HSD10 in PC12, rat adrenal gland tumour-derived cells, accelerated tumour growth in both culture monolayers and in severe combined immunodeficiency (SCID) mouse xenografts; this enhanced tumorigenicity was accompanied by increased mitochondrial complex IV activity and upregulated ATP production.23
The broad substrate range of 17β-HSD10 may explain why this enzyme was independently “rediscovered” several times across different fields, leading to a series of nomenclatures that reflect its diverse biological roles. For example, one of the earliest identifications of 17β-HSD10 in mammalian systems came from a yeast two-hybrid screen in HeLa cells. Here, it was determined to bind the amyloid beta (Aβ) peptide and was reported to localise to the endoplasmic reticulum (ER); hence, it was named endoplasmic reticulum amyloid binding (ERAB) protein.12 Almost simultaneously, biochemical purification studies14 identified a mitochondrial short-chain dehydrogenase (SCHAD) and classified it as L-3-hydroxyacyl-CoA dehydrogenase based upon its activity towards β-oxidation intermediates.14,18 Shortly thereafter, the same gene product was proposed to possess alcohol dehydrogenase activity and ability to bind Aβ directly, giving rise to the revised name Aβ-binding alcohol dehydrogenase (ABAD).17 This naming was also a departure from the previously used ERAB, and the associated misconception of sole localization in the endoplasmic reticulum, which was overturned after new discoveries, obtained through GFP-tagged intracellular experiments, evidently localized the protein within the mitochondria.24 In parallel, clinical geneticists investigating inborn errors of metabolism identified a male patient with X-linked neurodegenerative disease caused by mutations in the same gene.25 The authors coined the protein product 2-methyl-3-hydroxybutyryl-CoA dehydrogenase (MHBD)15,25 and proposed a crucial role in isoleucine catabolism. It was recognised only later that these independently described proteins were identical entities. Previously, in 1996, the enzyme was identified in bovine mitochondria,26 and mass spectrometry work of Ofman et al. (2003)15 later revealed that purified MHBD from bovine liver was identical to purified bovine 3-hydroxyacyl-CoA dehydrogenase type II (HADH2), resulting in the combining of science under these two names. The name HADH2 was attributed to the discovered function of catalysing the redox conversion between L-3-hydroxyacyl-CoA and 3-ketoacyl-CoA.14 Ofman et al. (2003)15 recognized the human homolog of this studied bovine enzyme as being ERAB within the short-chain 3-hydroxyacyl-CoA dehydrogenase family. The unifying nomenclature, 17β-HSD10, was subsequently adopted following the discovery that the enzyme also catalyses the oxidation of 17β-estradiol (E2), allopregnanolone (AlloP) and 3α-androstanediol.27 In 2008, the focal enzyme was also termed MRPP2 by Holzmann et al., named for its association with mtRNase P activity, but was clearly also identified by its accompanying breadth of names.28 Although it has also been referred to as SDR5C1, denoted for its membership in the short-chain dehydrogenase/reductase superfamily,29–31 the focal enzyme of this review is presently identified as 17β-HSD1032. In 2007, the gene symbol, HSD17B10, was officially adopted by the Human Gene Nomenclature Committee (HGNC)33 and has since been used consistently across multiple studies.
Endogenous 17β-HSD10 substrates and functions
1 Steroidal substrates
The lipid-soluble steroid hormones, oestrogens and androgens, are amongst the most important physiological substrates of 17β-HSD10.34 These cholesterol-derived signalling molecules play vital roles in a wide range of processes, including reproduction, development, metabolism and immune function.35–38 In particular, neurosteroids are known to be crucial in brain development, neuroprotection and neurogenesis, with dysregulation strongly implicated in both HSD10 deficiency and AD.39 For example, AlloP, which is oxidised by 17β-HSD10 to form 5α-dihydroprogesterone (5α-DHP) in an NAD+-dependent manner (Fig. 1A), is a potent positive allosteric modulator of γ-aminobutyric acid type A receptors (GABAAR) and is essential for maintaining a variety of neurological functions, including normal GABAergic tone.40 Investigations have shown that excessive 17β-HSD10 activity disrupts GABAergic signalling, which ultimately contributes to excitotoxic vulnerability via reduction in AlloP bioavailability.19,40
 |
| | Fig. 1 Reactions catalysed by 17β-HSD10 in steroid and isoleucine metabolism. (A) In progesterone metabolism, AlloP is oxidised to form 5α-dihydroprogesterone. (B) In androgen metabolism, 3α-androstanediol is converted to 5α-dihydrotestosterone (DHT). (C) In estrogen metabolism, 17β-estradiol is oxidised to estrone. (D) In isoleucine catabolism, 2M3HBA is converted to 2MAA-CoA. In all reactions, NAD+ serves as a cofactor and is reduced to NADH. Km values are reported in ref. 19, 34 and 35. | |
Furthermore, 17β-HSD10 also catalyses the oxidation of 3α-androstanediol into dihydrotestosterone (DHT) (Fig. 1B), linking the enzyme to androgen metabolism.19 In prostate cancer, this reaction contributes to a non-classical androgen synthesis pathway, allowing tumour cells to generate DHT even under androgen-deprivation therapy.41,42 This bypass mechanism provides an additional source of DHT, despite suppressed circulating testosterone, and promotes continued androgen receptor signalling, often giving rise to treatment resistance.43
One of the most significant reactions catalysed by 17β-HSD10 is the oxidation of E2 (estradiol) to E1 (estrone) (Fig. 1C), with the former supporting essential roles in both female and male physiology, contributing to reproductive function, lipoprotein synthesis, prevention of genital atrophy, regulation of insulin sensitivity and maintenance of cognitive and neuronal function.44,45 Beyond its canonical role as a sex hormone, E2 acts directly on neurons, astrocytes, microglia and neural stem cells, where it modulates ion channel activity and intracellular signalling cascades such as the cyclic adenosine monophosphate (cAMP),46 mitogen-activated protein kinase (MAPK)47 and protein kinase B (Akt)48 pathways. Additionally, upon binding to nuclear estrogen receptors alpha (ERα) and beta (ERβ), E2 induces receptor dimerisation and translocation to the nucleus, regulating gene expression in a cell-specific manner,49 and subsequently influencing cognition, mood, motor function and neuroprotection.50–52
Critically, a substantial portion of E2's neuroprotective effects are mediated via signalling pathways that converge on cellular survival mechanisms, particularly within the mitochondria.53,54 In primary hippocampal neurons, E2 activates the phosphatidylinositol 3-kinase (PI3K/Akt) and MAPK signalling cascades to protect against glutamate-induced cytotoxicity.55,56 These pathways stabilise mitochondrial calcium buffering and increase the expression of anti-apoptotic proteins, such as B cell lymphoma-2 (BCl-2), thus preventing initiation of the apoptotic cascade.53 In addition, E2 also plays a crucial role in neuronal bioenergetics, enhancing mitochondrial efficiency by upregulating key metabolic enzymes such as pyruvate dehydrogenase, complex IV of the electron transport chain (ETC) and ATP synthase, thereby expediting glycolysis and oxidative phosphorylation.53,57 Consequently, E2 serves to reduce mitochondrial oxidative stress, preserve membrane potential and maintain overall mitochondrial integrity.58 At the synaptic level, E2 rapidly enhances dendritic spine formation through ERβ activation in cortical neurons.59 This facilitates synaptic transmission and long-term potentiation (LTP) in the hippocampus by activating the RhoA/ROCK signalling pathway, facilitating actin polymerisation and stabilisation of the synaptic cytoskeleton.59,60
Collectively, these mechanisms highlight E2 as a critical neuroprotective steroid whose actions span mitochondrial regulation, synaptic plasticity and pro-survival signalling. Consequently, aberrant 17β-HSD10 activity, be it through overexpression23 or Aβ-mediated dysregulation,12 has the potential to disrupt E2 signalling and therefore contribute to mitochondrial dysfunction, synaptic instability and increased vulnerability to neurodegenerative diseases such as AD. Moreover, the decline in circulating estradiol levels during menopause may further exacerbate these effects, leading to a decrease in E2-mediated neuroprotective effects and increasing susceptibility to AD in menopausal women.61
2 Non-steroidal substrates
In addition to its roles in neurosteroid and systemic steroid metabolism, 17β-HSD10 also mediates catabolism of branched chain amino acids (BCAAs) within the mitochondria, catalysing a key step in the isoleucine degradation pathway (Fig. 1D) via oxidation of 2-methyl-3-hydroxybutyryl-CoA (2M3HBA) to 2-methylacetoacetyl-CoA (2MAA-CoA) in an NAD+-dependent manner.25,62 Unlike the other BCCAs, leucine and valine, isoleucine is both ketogenic and glucogenic, ultimately giving rise to acetyl-CoA and propionyl-CoA (Fig. 2), respectively.63 The former is a major precursor in the synthesis of ketone bodies and fatty acids,64 while the latter contributes to gluconeogenesis via conversion to oxaloacetate,65,66 with both acting as key intermediates in the tricarboxylic acid cycle (TCA), generating high-energy electron carriers NADH/FADH2 for oxidative phosphorylation and GTP/ATP by substrate-level phosphorylation.15,67,68 Evidently, the importance of isoleucine metabolism is further supported by genome-wide association studies (GWAS), which identified a positive relationship between genetic predisposition to raised plasma isoleucine levels and the development of AD.69 This critical factor reinforces the importance of proper 17β-HSD10 activity to sustain mitochondrial energy supply, particularly in high-demand tissues such as the brain.
 |
| | Fig. 2 Schematic overview of the mitochondrial degradation of isoleucine to acetyl-CoA and propionyl-CoA. Isoleucine is first transaminated to 2-keto-3-methylvaleric acid by branched-chain amino acid aminotransferase (BCAT), followed by oxidative decarboxylation by the branched-chain α-ketoacid dehydrogenase complex (BCKDH) to yield 2-methylbutyryl-CoA. Sequential enzymatic steps catalysed by 2-methylbutyryl-CoA dehydrogenase (SBCAD) and enoyl-CoA hydratase produce tiglyl-CoA and 2M3HBA, respectively. 17β-HSD10 then catalyses the NAD+-dependent oxidation of 2M3HBA to 2MAA-CoA which is subsequently cleaved by acetoacetyl-CoA thiolase to generate acetyl-CoA and propionyl-CoA.63,70 | |
As briefly alluded to above, HSD10 deficiency, also referred to as HSD10 disease, 17β-HSD10 deficiency, HSD10 mitochondrial disease and MHBD deficiency, is a rare X-chromosome-linked disease caused by missense mutations of the HSD17β10 gene.71–74 First identified in 2000, in a 2-year-old male patient through urinary metabolite analysis, this rare disease is characterized by clinical symptoms of neurodegeneration, impaired motor control, psychomotor delay, regression of previously acquired motor and cognitive skills, choreoathetosis, cardiomyopathy, abnormal metabolic function, seizures,25,73 cognitive impairment, epilepsy,10 retinopathy74 and mitochondrial dysfunction.75 The clinical phenotype is dependent upon the exact mutation position.32 Clinical forms of this disease present as neonatal, infantile and juvenile forms, all with severely reduced patient lifespan.10 It was subsequently determined that loss of enzymatic function results in the upstream accumulation of 2M3HBA, producing a toxic organic acid load that can be detected in urine as 2-methyl-3-hydroxybutyrate (2M3HB).15,25 This metabolic block prevents the downstream formation of acetyl-CoA and propionyl-CoA, substantially impairing mitochondrial energy production.15 There is currently no known effective treatment,10,73,74 and while adopting an isoleucine-restricted diet may decrease the metabolites (2M3HB and tiglyglycine) in the urine, clinical symptoms of this deficiency do not exhibit any improvement or slow in progression.21,25,73,74,76 While it was initially thought that HSD10 deficiency pathology arose exclusively due to inborn errors in isoleucine metabolism,25 this earlier hypothesis was proved incorrect following the discovery in human tissues that mitochondrial energy failure in HSD10 deficiency is caused by abnormal mitochondrial RNA processing.77 This came after 17β-HSD10 was identified to be a component of the mitochondrial RNase P complex,28 which provides post-transcriptional processing of RNAs into mitochondrial mRNAs, tRNAs and rRNAs.77 Northern blots performed on heart tissue from control and diseased patients revealed elevated levels of unprocessed RNA in samples with HSD10 deficiency.77 The disease phenotypes ultimately arise from failure in mitochondrial energy production within the developing nervous system. Taken together, these findings demonstrate that impaired isoleucine catabolism and irregular mitochondrial RNA processing lead to augmented metabolic stress and serve as key contributors to neuronal death.
Similarly, decreased 17β-HSD10 levels have been measured in the brains of Parkinson's disease (PD) patients.72,78 PD is a neurodegenerative disease with a primary neuropathological hallmark of degradation of the dopaminergic neurons in the substantia nigra pars compacta in the ventral midbrain, a region essential for movement and motor control.72,78 PD is characterized by primary impairments of rest tremor, bradykinesia, limb and trunk stiffness and postural instability with freezing of gait.79 Compared to wild-type littermates, transgenic mice overexpressing human 17β-HSD10 fourfold were shown to be more resistant to the neurotoxin 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine, a toxin which impairs mitochondrial respiration and degrades dopaminergic neurons.78 In this same series of experiments, western blot analysis of human tissue samples obtained from the Parkinson Brain Bank at Columbia University revealed reduced levels of 17β-HSD10 in the ventral midbrain region of post-mortem samples of PD patients when compared to control subjects.78 Thus, there is evidently a required balance of the expression of this enzyme,80 in prevention of AD at one end and PD at the other.23 Further investigation could provide treatment clarity as to the more specific importance of the effects of altering the expression of a catalytically inactive vs active form of the enzyme and subsequently provide a therapeutic foundation for treatment of PD and HSD10 deficiency.
3 Non-enzymatic functions of 17β-HSD10
While enzymatic activities in steroid and isoleucine metabolism are well-established, 17β-HSD10 has also been shown to operate via noncatalytic interactions with other proteins, including ERα, cyclophilin D (CypD) and the mitochondrial RNase (mtRNase) P complex.23,28,81,82
Specifically, 17β-HSD10 forms a crucial component of the human mitochondrial RNase P (mtRNase P) complex.28 This multi-subunit complex serves as a protein-only endonuclease that cleaves the 5′ leader sequence from pre-transfer tRNA (tRNA) to generate mature tRNA83 (Fig. 3). Human mtRNase P was long presumed to contain a trans-acting RNA component, analogous to the ribozyme-based RNase P systems found in prokaryotes and eukaryotic nuclei.84 This assumption, however, was disproven when the mitochondrial enzyme was found to be composed entirely of three nuclear-encoded protein subunits: tRNA methyltransferase (MRPP1/TRMT10C), 17β-HSD10 (MRPP2/SDR5C1) and Mg2+-dependent endoribonuclease (MRPP3/PRORP).28,85 Within this complex, MRPP2 forms a stable subcomplex with MRPP1, serving as a structural platform, with ancillary roles in mitochondrial tRNA-binding and methylation, which facilitate catalytic activity of the MRPP3 subunit.28 The MRPP2, i.e. the 17β-HSD10 component, is comprised of a homotetramer, with each monomer adopting a Rossmann fold to yield a dehydrogenase active site capable of binding the NAD+ cofactor;28 however, within the context of mtRNase P, this domain is repurposed as a tRNA-binding motif.28,86 The importance of MRPP2 has been highlighted by knockdown studies, which demonstrated that MRPP2 knockdown resulted in the accumulation of unprocessed mitochondrial tRNA precursors and impaired mitochondrial translation machinery.28,77 Furthermore, MRPP2 has also been identified as a critical determinant for the stable expression of MRPP1, experimentally evidenced, for example, where single point mutations, such as R130C, in 17β-HSD10, led to a reduction in MRPP2 and a concomitant loss of MRPP1, resulting in impaired RNase P activity and defective RNA processing.87
 |
| | Fig. 3 Non-enzymatic role of 17β-HSD10 (MRPP2) in mitochondrial tRNA processing. 17β-HSD10 forms a complex with MRPP1 and MRPP3 in mitochondria to regulate tRNA maturation. (A) In the methylation pathway, MRPP1-17β-HSD10 is associated with catalyse N1-methylation of guanosine at position 9 (m1G9) of precursor tRNA using S-adenosylmethionine (SAM) as a methyl donor,88 with 17β-HSD10 providing a structure stabilising role.28 (B) In the endonuclease pathway, the MRPP1-17β-HSD10-MRPP3 complex forms mtRNase P,28 where MRPP3 functions as the catalytic endonuclease, responsible for 5′ cleavage of precursor tRNA.28 This cleavage requires Mg2+ as a cofactor and generates mature 5′-processed tRNA.28 Created in BioRender. Lab, G. (2026) https://BioRender.com/fw89upy. | |
Another non-enzymatic interaction between 17β-HSD10 and ERα (Fig. 4) within the mitochondria has been documented, suggesting that the enzyme plays a role in regulating local hormone signalling. This interaction was first observed in neonatal rat cardiomyocytes, where 17β-HSD10 was found to bind directly to the ligand-binding domain of ERα in a hormone-sensitive manner.81 In these studies, the complex remained intact and 17β-HSD10 activity was inhibited under low estrogen conditions; however, when mitochondrial E2 levels increased, ERα dissociated from the complex, allowing 17β-HSD10 to freely oxidise E2 to E1, ultimately resulting in signal termination. This characteristic led to a model in which 17β-HSD10 functions as a mitochondrial estrogen sensor and regulator.81
 |
| | Fig. 4 A diagram depicting the interaction of ERα and 17β-HSD10. Under low concentrations of E2, 17β-HSD10's enzymatic activity is inhibited by ERα. In the presence of high E2, ERα dissociates from 17β-HSD10, allowing 17β-HSD10 to catalyse the conversion of highly potent E2 to less potent E1. Figure adapted from ref. 81, Biochemical and Biophysical Research Communications, 384(4), V. Jazbutyte, F. Kehl, L. Neyses and T. Pelzer, Estrogen receptor alpha interacts with 17β-hydroxysteroid dehydrogenase type 10 in mitochondria, pp. 450–454, copyright 2009, with permission from Elsevier. Created in BioRender. Lab, G. (2026) https://BioRender.com/on5sshe. | |
In addition, another important binding partner of 17β-HSD10 is the mitochondrial regulator CypD. A combination of co-immunoprecipitation and immunofluorescence studies in PC12 cells has shown that overexpression of 17β-HSD10 increased the formation of the 17β-HSD10-CypD complex, whereas knockdown of 17β-HSD10 yielded a reduction in CypD levels.23 Under oxidative stress, CypD typically translocates from the mitochondrial matrix into the inner mitochondrial membrane, where it facilitates opening of the mitochondrial permeability transition pore (MPTP), a key event that drives apoptosis or necrosis.23,89 Enhanced binding of CypD by 17β-HSD10 appears to retain CypD within the matrix, thus preventing stress-induced translocation. As such, MPTP opening is inhibited, conferring resistance to oxidative stress-induced mitochondrial dysfunction and limiting misguided apoptosis that would conversely lead to cell death. This interaction suggests that 17β-HSD10 can modulate mitochondrial vulnerability to injury, in addition to its enzymatic activities.
Dual mechanisms of 17β-HSD10 in Alzheimer's disease pathogenesis
The mitochondrial enzyme 17β-HSD10 additionally plays a critical role in the pathophysiology of AD through two primary mechanisms, both of which contribute to neurodegeneration.
The first pathological mechanism is the overexpression of 17β-HSD10 in AD brains, which, as described above, disrupts neurosteroid metabolism and homeostasis.71 Excessive enzymatic activity accelerates the degradation of E2 and AlloP, leading to decreased levels of these important protective neurosteroids.90,91 This reduction leads to decreased ATP production, causing dysregulation of bioenergetics and redox homeostasis, which contributes to mitochondrial dysfunction.92,93 Independent of AD, cellular studies have shown that overexpression of 17β-HSD10 can itself induce cellular damage, reduce viability and impair mitochondrial function in a manner dependent upon its catalytic activity, suggesting that it acts as an independent pathological factor.71,94
The second major pathological role of 17β-HSD10, involves its interaction with one of the well-documented pathogenic hallmarks of AD, Aβ aggregates.93 The most direct link is 17β-HSD10's ability to bind Aβ, particularly the plaque-forming isoforms Aβ(1–40) and Aβ(1–42).20 Aβ enters neuronal mitochondria, where it associates with 17β-HSD10 via a unique binding site called loop D (92–120); this region forms a short β-hairpin structure exposing key residues, Thr108, His109 and Thr110 for protein–protein interactions.20,95 It is thought that binding of Aβ to 17β-HSD10 results in a conformational change, which prevents normal enzymatic function via blockage of the NAD+ cofactor and/or substrate binding sites.20 This binding event has been shown to be cytotoxic in vitro, leading to an increase in reactive oxygen species (ROS), inhibition of mitochondrial complex IV and the release of cytochrome c and lactate dehydrogenase, ultimately leading to apoptosis.20,95,96 Evidence from cell viability assays and transgenic experiments shows that disruption of the Aβ-17β-HSD10 interaction leads to positive effects on mitochondria, mitigating oxidative stress and Aβ-induced toxicity.20
Inhibitors of 17β-HSD10
Following the above, the targeted modulation of 17β-HSD10 presents a promising direction for the development of future therapeutics for the treatment of AD.43 The goal is to mitigate Aβ-induced cytotoxicity, while restoring neuroprotective steroidal balance in neurons. Unfortunately, the search for novel and promising inhibitors of 17B-HDS10 has proved challenging. To date, several compounds have been repurposed or created de novo to target either Aβ-17β-HSD10 interactions or to directly inhibit 17β-HSD10 activity.12,20,97 Based upon their structure and function, these inhibitors can be broadly classified into 5 major groups: loop D mimetics, benzothiazolyl ureas, fused pyrazole compounds, steroidal compounds, and repurposed drugs and other compounds.
Loop D mimetics
Early efforts to disrupt the pathological interaction between 17β-HSD10 and Aβ focused on peptide-based mimetics derived from the loop D region of the enzyme, which forms the Aβ-binding interface (Fig. 5). For example, Lustbader et al. (2004)20 first synthesised a peptide dubbed ABAD-decoy peptide (ABAD-DP) using the corresponding amino acid residues (92–120). The peptide effectively inhibited binding between 17β-HSD10 and both Aβ(1–40) and Aβ(1–42) in vitro, with IC50 values of 4.9 µM and 1.7 µM, respectively. To investigate peptide activity in vivo, ABAD-DP was bioengineered to incorporate additional sequences.98 The construct encoded the Tat protein transduction domain of the HIV1 virus to ensure transport across the cell membrane and blood–brain barrier (BBB) and a mitochondrial targeting sequence (Mito) to ensure specificity translocation into neuronal mitochondria. This construct, termed Tat-Mito-DP, effectively inhibited the Aβ–17β-HSD10 interaction, which preserved mitochondrial function and improved spatial memory in transgenic mouse models of AD; however, the therapeutic potential of this peptide was limited by its short in vivo half-life.98 To address the issue, an attempt at stabilisation was ventured via fusion with thioredoxin-1 (Trx-1).99 This modification enhanced stability and prolonged ABAD-DP activity, allowing the conjugate to successfully protect against Aβ-induced cytotoxicity and re-establish redox balance in PC12 cells.99 However, later studies using the thioredoxin-fused peptide aptamers shifted focus towards disrupting interactions between toxic Aβ assemblies and cellular prion proteins (PrPc).100
 |
| | Fig. 5 Crystal structure of the human 17β-HSD10 homotetramer with each subunit represented by different colours and the loop D region highlighted in green (PDB: 1U7T). | |
Given the limited bioavailability and short half-life of peptide-based mimetics, efforts were refocused on developing non-peptidyl small molecule inhibitors to target the loop D interface.95 A combination of computational and structural analyses identified three key residues: Thr108, His109 and Thr110, which act as hotspots mediating Aβ–17β-HSD10 interactions.95 Virtual screening of chemical databases formed the basis of in silico drug discovery, followed by enzyme-linked immunosorbent assay (ELISA)-based verification of the top 20 hits, which identified 2 lead compounds, VC15 and VC19 (Table 1), with IC50 values of 4.4 µM and 9.6 µM, respectively.95 At a structural level, the inhibitory activity of VC15 and VC19 is mediated by hydrophobic interactions and hydrogen bonding that engages with Aβ residues such as Phe4, Glu11 and Gln15 within the loop D pocket. The authors noted that of the two compounds, VC19 yielded a superior binding score. VC19, however, demonstrated lower in vitro potency compared to VC15. This difference in potency was ascribed to VC15 forming a greater number of polar interactions within the Aβ-binding pocket compared to VC19.95
Table 1 Names and structures of loop D mimetic inhibitors. Inhibitor names are shown as they appear in the original literature
| Compound |
IC50 (µM) |
Assay type |
Inhibition type |
Type |
Sequence/structure |
Ref. |
| ABAD-DP |
1.70 |
Cell based |
Aβ-interaction |
Peptide |
AGIAVASKTYNLKKGQTHTLEDFQRVLDV |
20 |
| Tat-Mito-ABAD-93-116 |
— |
Mice based |
Aβ-interaction |
Peptide |
YGRKKRRQRRR-MAAAVRSVKGL-GIAVASKTYNLKKGQTHTLEDFQR |
98 |
| VC15 |
4.40 |
ELISA based |
Aβ-interaction |
Small molecule |
 |
95 |
| VC19 |
9.60 |
ELISA based |
Aβ-interaction |
Small molecule |
 |
95 |
Benzothiazolyl ureas
Benzothiazolyl ureas are a class of organic compounds consisting of a benzothiazolyl heterocycle linked via a urea bridge to various aryl moieties.101,102 These small molecules display diverse biological activities, and their scaffolds are routinely utilised in medicinal chemistry, forming the basis of various anti-cancer, anti-bacterial and AD therapeutics.103 The discovery of benzothiazolyl ureas as inhibitors of 17β-HSD10, originated from ELISA-based screening assays designed to identify 17β-HSD10 and Aβ binding partners.104 These investigations identified frentizole, an FDA-approved immunosuppressive drug, as a novel 17β-HSD10–Aβ inhibitor, with an IC50 of 200 µM (Table 2).104 Despite initially exhibiting suboptimal potency, the frentizole scaffold provided an important structural template for further optimisation, leading to the synthesis of a series of benzothiazolyl urea analogues, which enabled the analysis of structure–activity relationships (SAR), with several derivatives having demonstrated up to a ∼30-fold increase in potency relative to frentizole.104
Table 2 Names and structures of benzothiazolyl urea inhibitors. Inhibitor names are shown as they appear in the original literature
| Compound |
IC50 (µM) |
Assay type |
Inhibition type |
Structure |
Ref. |
| Frentizole |
200 |
ELISA based |
Aβ-interaction |
 |
104 |
| 5h |
6.46 |
ELISA based |
Aβ-interaction |
 |
104 |
| 5l |
6.56 |
ELISA based |
Aβ-interaction |
 |
104 |
| Compound 9 |
0.34 |
Recombinant protein |
Enzymatic |
 |
105 |
| Compound 11 |
0.31 |
Recombinant protein |
Enzymatic |
 |
105 |
| Compound 5 |
1.28 |
Recombinant protein |
Enzymatic |
 |
102 |
| Compound 6 |
1.86 |
Recombinant protein |
Enzymatic |
 |
102 |
These SAR studies revealed the urea, rather than an amide moiety, to be essential for inhibition of 17β-HSD10–Aβ protein–protein interactions. The authors attributed this key pharmacophore element to the hydrogen-bond donor ability of the urea-NH groups. The addition of a para-hydroxyl group to the phenyl-urea ring yielded a hydroxyphenyl urea derivative with increased potency, whilst further modifications combining hydroxyl and methoxycarbonyl functionalities led to the development of the most potent compounds 5h and 5l (Table 2).104
A later study conducted by Hroch et al. (2016)101 showed a 4-phenolic moiety with chlorine in close proximity to be crucial for 17β-HSD10 inhibition, with a 3-halogen/4-hydroxyl substitution on the distal phenyl ring demonstrating potent inhibition. These findings provided a foundation for further optimisation and refinement of candidate compounds. Consequently, Aitken et al. (2019)102 synthesised and expanded upon this, thereby identifying compounds 5 and 6 (Table 2) as the most promising candidates featuring either a 3-bromo or 3-iodo in conjunction with a 4-hydroxyl substitution. Enzyme inhibition assays showed that both compounds act via reversible, mixed-type inhibition. This mechanism contrasts with the then “gold standard” 17β-HSD10 inhibitor, AG18051 (Table 3) (see below), which exerts inhibition via an irreversible covalent modification of the NAD+ cofactor.90 Thus, the benzothiazolyl ureas’ mixed reversible mode of inhibition is favourable as it implies greater selectivity and reduced off-target reactivity toward other NAD+-dependent short-chain dehydrogenase/reductase (SDR) family members.102
Table 3 Names and structures of pyrazole-derived inhibitors. Inhibitor names are shown as they appear in the original literature
| Compound |
IC50 (µM) |
Assay type |
Inhibition type |
Structure |
Ref. |
| AG18051 |
0.092 |
Recombinant protein |
Enzymatic |
 |
90 |
| Compound 14b |
0.74 |
ELISA based |
Enzymatic |
 |
106 |
Recent studies have further probed the effects of substitutions on the benzothiazolyl core, specifically at the C6 position,105 where either a large hydrogen-bond acceptor or a small hydrogen bond donor modulates multiple electrostatic and steric interactions within the enzyme binding site. Subsequent optimisation led to the identification of submicromolar inhibitors, notably compounds 9 and 11, which have IC50 values of 0.34 µM and 0.31 µM, respectively (Table 2).105
Taken together, these findings show the evolution of benzothiazolyl urea entities from a known class of compounds, repurposed into a chemically distinct class of 17β-HSD10 inhibitors with significantly improved potency and selectivity.
Pyrazole derivatives
For many years, the most potent and widely studied inhibitor of 17β-HSD10 was AG18051 (Table 3), with an IC50 of 92 nM.90 Structurally, AG18051 is 1-azepan-1-yl-2-phenyl-2-(4-thioxo-1,4-dihydro-pyrazolo[3.4-d]pyrimidin-5-yl)-ethanone, whereby its N2 atom forms a covalent adduct with the C4 carbon atom on the nicotinamide ring of the 17β-HSD10-bound NAD+ cofactor. This irreversible modification disrupts the 17β-HSD10-NAD+ holoenzyme, leading to suppressed activity. However, the covalent nature of this inhibition raises concerns regarding off-target reactivity and therapeutic viability.90
Molecular dynamic simulations provided further insight into the structural relationship between AG18051 and its binding site.107 These studies highlighted substantial conformational flexibility displayed by the azepane and benzene rings of AG18051, which correlates with the dynamic mobility of the 17β-HSD10 substrate-binding loop.107 This suggests that, in the absence of a ligand, the substrate-binding loop remains highly flexible, whereas AG18051 binding leads to stabilisation of the active site.107 In cell culture assays, using SH-SY5Y (human neuroblastoma) cells, AG18051 was shown to reduce ROS formation, protect against Aβ-induced cytotoxicity and prevent the Aβ-mediated decrease in estradiol.108 Such neuroprotective effects lend significant merit to pursue 17β-HSD10 as a therapeutic target for the treatment of AD.
Despite its potency and well-documented mechanism of action, the irreversible covalent binding mode raises concerns over off-target effects, specifically for other essential NAD+-dependent SDR enzymes, thus limiting translational applicability and precluding AG18051 as a viable candidate for AD therapy. AG18051, however, continues to serve as the standard reference compound for both in vitro and in vivo studies and remains a valuable benchmark control for the synthesis of novel 17β-HSD10 inhibitors.
Building upon the fused-pyrazole structure of AG18051, Morsy et al. (2022)106 replaced the original azepane ring with alternative nitrogen-containing heterocycles to create a series of ‘functionalised allopurinols’ with improved physiochemical properties and brain penetrance. Within this series, compound 14b (LD14b) (Table 3) had the original azepane ring replaced with a piperidinyl alcohol group, markedly increasing potency and optimisation scores. In silico modelling suggests that LD14b stabilises 17β-HSD10 by engaging Gly199, Thr203 and Leu22 within the Aβ-interface.106 In E2 rescue assays, LD14b presented submicromolar inhibition with an IC50 of 0.74 µM, in addition to protecting SH-SY5Y cells from Aβ-induced cytotoxicity and preventing Aβ-induced mitochondrial dysfunction and abnormal mitochondrial morphology in cortical neurons derived from 5XFAD mice.106 In light of these results, Daria et al. (2024)109 conducted detailed absorption, distribution, metabolism and excretion (ADME) studies to determine pharmacokinetic (PK) parameters for LD14b, showing good metabolic stability, with ∼70% of the parent compound detected in human liver S9 fractions after 90 minutes. Caco-2 permeability assays, demonstrated that LD14b exhibits intermediate intestinal drug absorption and BBB penetration capabilities. Furthermore, LD14b also showed moderate oral bioavailability with a 3–5 hour half-life and large volume of distribution, suggesting broad tissue exposure.109
Steroidal derivatives
The demonstrated ability of 17β-HSD10 to metabolise steroidal substrates34 suggests that its active site could accommodate steroidal scaffolds, making steroidal derivatives a promising candidate for inhibitor development. As such, a variety of compounds were predicted to interact with the 17β-HSD10 binding pocket, and several steroid-based inhibitors were subsequently synthesised and evaluated for their ability to modulate enzymatic activity (Table 4).43
Table 4 Names and structures of steroidal derived inhibitors. Inhibitor names are shown as they appear in the original literature
| Compound |
IC50 (µM) |
Assay type |
Inhibition type |
Structure |
Ref. |
| RM-532-46 |
0.55 |
Cell based |
Enzymatic |
 |
43 |
| D-3,7 |
0.14 |
Cell based |
Enzymatic |
 |
113 |
| Compound 23 |
5.59 |
Recombinant protein |
Enzymatic |
 |
91 |
Among the candidates, a lead compound RM-532-46 (Table 4) showed promise, with an IC50 of 0.55 µM.43 Despite its potency, RM532-46 was deemed unsuitable due to being derived from DHT, a compound known to inhibit 17β-HSD3. This enzyme catalyses the conversion of androstenedione to testosterone,42,110 a key step in androgen biosynthesis. As prostate cancer is driven by androgen receptor signalling,111 inhibition of 17β-HSD3 poses as a potential therapeutic strategy to suppress androgen production. Consequently, this cross-reactivity suggests that RM-532-46 would likely be more appropriate as a drug targeting prostate cancer rather than a selective drug targeting AD.43
From the structure of RM-532-36, Boutin et al. (2018)112 synthesised a series of 15 analogues and evaluated inhibitory effects against two natural steroidal substrates, AlloP and E2. The results revealed substrate-dependent differences in inhibitory potency, where compound 5 was the most effective when assayed with AlloP and less so with E2, yielding IC50 values of 235 µM and 610 µM, respectively. As predicted, compound 5 also demonstrated the ability to cross the BBB, with a BBB penetration score of −2.61. In contrast, compound 8 showed the highest potency with the E2 substrate, with an IC50 of 300 µM, but exhibited minimal inhibition against AlloP, suggesting that certain structural features select for particular substrates.112
Further optimisation of the same RM-532-46 compound introduced different modifications to its core scaffold, including D-ring, side chain and dual hybrid modifications.113 These investigations yielded a D-ring-modified amine derivative, known as D-3,7 (Table 4), which demonstrated excellent potency with an IC50 value of 0.14 µM.113 Additional selectivity testing also indicated that D-3,7 had overcome the initial lack of specificity presented by RM-532-46113
In contrast, other derivatives, such as compound 23 (Table 4), demonstrated more moderate inhibitory activity with an IC50 of 5.59 µM,91 highlighting the variability in potency associated with structural modifications within steroidal derivatives.
Repurposed and other compounds
With a surge in drug repositioning, several clinically established compounds have been repurposed for the treatment of additional diseases.114 One such compound is risperidone (Table 5), an FDA-approved drug for the treatment of schizophrenia and bipolar disorder.115,116 In a chemical genomic screen using a T7 bacteriophage display library, risperidone was identified as a potential 17β-HSD10 inhibitor. Enzyme assays demonstrated that 17β-HSD10 activity with E2 and acetoacetyl-CoA substrates resulted in oxidation of E2 and reduction of acetoacetyl-CoA at rates of 1.0 µM min−1 and 3.3 µM min−1, respectively.117 Moreover, in silico computational docking experiments ranked risperidone among the highest-scoring ligands for 17β-HSD10 and predicted the compound to act as a competitive inhibitor;117 however, empirical pharmacodynamic parameters and inhibitor specificity are yet to be determined, with further biochemical and structural validation required.
Table 5 Names and structures of novel and repurposed drugs as 17β-HSD10 inhibitors. Inhibitor names are shown as they appear in the original literature
| Compound |
IC50 (µM) |
Assay type |
Inhibition type |
Structure |
Ref. |
| Risperidone |
— |
Recombinant protein |
Enzyamtic |
 |
117 |
| BCC0100281 |
25.1 |
Recombinant protein |
Enzymatic |
 |
120 |
| ESC1002755 |
0.019 |
Recombinant protein |
Enzymatic |
 |
97 |
| ESC1002576 |
0.25 |
Recombinant protein |
Enzymatic |
 |
97 |
In 2017, Aitken et al. conducted a pilot high-throughput screening (HTS) of 6759 compounds, which identified 16 low-micromolar inhibitors of 17β-HSD10. Physiochemical profiling revealed that all hits exhibited favourable drug-like properties, establishing a strong foundation for subsequent SAR optimisation and in vivo validation, and thus enabling the development of 17β-HSD10-targeted therapeutics.118 Building upon this work, Dow et al. (2025)119 selected BCC0100281 (Table 5) for further investigation, in which cell-based assays displayed marked cytotoxicity in SH-SY5Y neuroblastoma cells, precluding further use in Aβ-induced cytotoxicity.119 Notably, this cytotoxic effect was not observed across a broader panel of cancer and non-cancer cell lines, highlighting a degree of cell-specific vulnerability. Further analysis by differential scanning fluorimetry (DSF) revealed a decrease in 17β-HSD10 thermal stability when assayed with BCC0100281, consistent with a non-canonical binding mode.119 Derivatives targeting modifications of the central pyrimidine scaffold were subsequently synthesised and found to exhibit protective effects against Aβ-induced cytotoxicity.119 These compounds, however, displayed an inverse dose–response relationship, indicating both mechanistic complexity and room for further optimisation. While BCC0100281 is unlikely to advance as a therapeutic lead, it nonetheless provides a valuable chemical starting point for the continued development of next-generation 17β-HSD10 inhibitors.
In 2025, Aitken et al. published the first industrial-scale HTS of 350
000 drug-like molecules, generating several lead series for the potent inhibition of 17β-HSD10. From the screening, two distinct compound series emerged for future development, a singleton hit series, ESC1002755 (Table 5) and a chemically related hit series referred to by the authors as cluster 6. From the cluster 6 series, ESC1002576 (Table 5) was selected as a lead compound. Although ESC1002576 did not exhibit the highest potency within cluster 6 (IC50 = 0.25 µM), it possessed the most favourable selection based on its overall potency and physiochemical properties.97 ESC1002755 (Table 5) yielded the highest potency against 17β-HSD10, with an IC50 of 19 nM in enzyme activity assays and an EC50 of 28 nM during overexpression of the canonical form in HEK293.97 Additionally, binding site analysis supported by co-crystallography of related compounds identified a novel allosteric site on 17β-HSD10 (Fig. 6). The novel allosteric site is bordered by Gln162, Gln165, Ser155 and Tyr168 residues, with the allosteric site and residues sitting adjacent to, but not overlapping the NAD+ cofactor binding site, explaining the non-competitive and competitive inhibition of NADH and acetoacetyl-CoA respectively. This allosteric mode of action distinguishes ESC1002755 from classic 17β-HSD10 active site inhibitors such has AG18051.97 Beyond its potency, ESC1002755 showed optimal selectivity and safety profiles in several cell-based assays, with minimal cell cytotoxicity.97 Moreover, screening of ESC1002755 against other SDR enzymes showed high selectivity for 17β-HSD10, while in vitro ADME assessments yielded favourable pharmacokinetic profiles.97
 |
| | Fig. 6 Interactions between 17β-HSD10 with specific novel compounds (A) ESC1002033, (B) ESC10023332 and (C) ESC1002421 sitting at a novel allosteric site. Figure taken from ref. 97, L. Aitken et al., ACS Chem. Biol., 2025, 20, DOI: https://doi.org/10.1021/acschembio.5c00110. Published by the American Chemical Society under a CC BY 4.0 licence. | |
Future perspectives
Significant strides have been made in the chemical design and optimisation of 17β-HSD10 inhibitors, which have resulted in the identification and synthesis of an array of compounds that span multiple chemical classes, with several compounds achieving submicromolar potency.97,105,113 Despite this progress, relatively little work has focused on their functional evaluation in physiologically relevant neuronal systems. Cellular studies, however, are moving in the right direction, with experiments being conducted using undifferentiated or non-neuronal cell models including HEK293 and SH-SY5Y neuroblastoma cell lines, as well as primary cortical neurons from AD mouse models.15,20,21,94,97,106,109,119 While these models have provided useful initial screening platforms, they still do not capture the complexity of the true in vivo microenvironment; more recent investigations, however, have been developing this capability. Houfková et al. (2025),94 for example, developed stable monoclonal HEK293 cell lines overexpressing HSD10, a catalytically inactive mutant, and an AD-associated mutation, APPSwe/Ind variant, thus allowing direct observation of the enzymatic and non-enzymatic contributions of HSD10 to cellular pathology. Critically, the study demonstrated that HSD10 overexpression alone is enough to induce mitochondrial dysfunction and cytotoxicity, independent of Aβ. This cytotoxicity was dependent upon HSD10 enzymatic activity, as the catalytically inactive HSD10 mutant did not present the phenotype. Importantly, cytotoxicity was only observed under glucose-deprived conditions,94 where cells are forced to rely upon mitochondrial oxidative phosphorylation, highlighting the critical role of metabolic context in modulating HSD10-driven toxicity.
Metabolic profiling further revealed that HSD10 overexpression led to broad suppression of tricarboxylic acid cycle activity and impaired β-oxidation. In contrast, the APPSwe/Ind cells exhibited increased glucose utilisation and upregulated β-oxidation, reflecting a compensatory mechanism to Aβ-induced mitochondrial stress.94
Despite emerging insights into 17β-HSD10 function, the efficacy and safety of these inhibitors in differentiated neuronal cell types, including astrocytes, oligodendrocytes and microglia, remain largely unknown, despite evidence linking 17β-HSD10 and its associated metabolic pathways to stress modulation in astrocytes and differentiation processes in oligodendrocytes.16 These findings emphasise the need to extend pharmacological assessments beyond the generic immortalised models to achieve a more accurate representation of physiological context. Indeed, the rise of mass spectrometry capabilities with these new potent inhibitor compounds will allow it to be possible to identify the metabolic changes caused by 17β-HSD10 activity in the living brain. As such, it is crucial that drug development pipelines for 17β-HSD10 inhibitors incorporate cellular differentiation assays and human induced pluripotent neuronal stem cell models. These approaches will shed light on how candidate compounds interact with distinct neural populations and will also provide mechanistic insights into their therapeutic action and neurotoxicity in disease-relevant contexts.
Conflicts of interest
There are no conflicts to declare.
Data availability
No primary research results, software or code have been included, and no new data were generated or analysed as part of this review.
References
- C. H. van Dyck, C. J. Swanson and P. Aisen, et al., Lecanemab in Early Alzheimer's Disease, N. Engl. J. Med., 2023, 388(1), 9–21, DOI:10.1056/NEJMoa2212948.
- J. Zhang, Y. Zhang, J. Wang, Y. Xia, J. Zhang and L. Chen, Recent advances in Alzheimer's disease: mechanisms, clinical trials and new drug development strategies, Signal Transduct Target Ther., 2024, 9(1), 211, DOI:10.1038/s41392-024-01911-3.
- A. V. Ivanova, A. D. Kutuzova, I. A. Kuzmichev and M. A. Abakumov, Alzheimer's Disease: From Molecular Mechanisms to Promising Therapeutic Strategies, Int. J. Mol. Sci., 2025, 26(19), 9444, DOI:10.3390/ijms26199444.
- E. Borger, L. Aitken, H. Du, W. Zhang, F. J. Gunn-Moore and S. S. Du Yan, Is Amyloid Binding Alcohol Dehydrogenase a Drug Target for Treating Alzheimer's Disease?, Curr. Alzheimer Res., 2013, 10(1), 21–29 CAS.
- L. Mosconi, Brain glucose metabolism in the early and specific diagnosis of Alzheimer's disease, Eur. J. Nucl. Med. Mol. Imaging, 2005, 32(4), 486–510, DOI:10.1007/s00259-005-1762-7.
- B. DuBoff, M. Feany and J. Götz, Why size matters – balancing mitochondrial dynamics in Alzheimer's disease, Trends Neurosci., 2013, 36(6), 325–335, DOI:10.1016/j.tins.2013.03.002.
- G. Moeller and J. Adamski, Integrated view on 17beta-hydroxysteroid dehydrogenases, Mol. Cell. Endocrinol., 2009, 301(1), 7–19, DOI:10.1016/j.mce.2008.10.040.
- M. Rotinen, J. Villar, J. Celay and I. Encío, Type 10 17β-hydroxysteroid dehydrogenase expression is regulated by C/EBPβ in HepG2 cells, J. Steroid Biochem. Mol. Biol., 2010, 122(4), 164–171, DOI:10.1016/j.jsbmb.2010.07.003.
- T. Jiang, W. Ouyang, H. Yang and S. Li, A novel c.59 C
>
T variant of the HSD17B10 gene as a possible cause of the neonatal form of HSD10 mitochondrial disease with hepatic dysfunction: a case report and review of the literature, Orphanet J. Rare Dis., 2025, 20, 108, DOI:10.1186/s13023-024-03513-2. - J. Zschocke, HSD10 disease: clinical consequences of mutations in the HSD17B10 gene, J. Inherit. Metab. Dis., 2012, 35(1), 81–89, DOI:10.1007/s10545-011-9415-4.
- M. Schmidt, O. Benek and L. Vinklarova, et al., Benzothiazolyl Ureas are Low Micromolar and Uncompetitive Inhibitors of 17β-HSD10 with Implications to Alzheimer's Disease Treatment, Int. J. Mol. Sci., 2020, 21(6), 2059, DOI:10.3390/ijms21062059.
- S. Du Yan, J. Fu and C. Soto, et al., An intracellular protein that binds amyloid-β peptide and mediates neurotoxicity in Alzheimer's disease, Nature, 1997, 389(6652), 689–695, DOI:10.1038/39522.
- S. Du Yan, Y. Zhu and E. D. Stern, et al., Amyloid β-Peptide-binding Alcohol Dehydrogenase Is a Component of the Cellular Response to Nutritional Stress, J. Biol. Chem., 2000, 275(35), 27100–27109, DOI:10.1016/S0021-9258(19)61485-7.
- X. Y. He, H. Schulz and S. Y. Yang, A Human Brain l-3-Hydroxyacyl-coenzyme A Dehydrogenase Is Identical to an Amyloid β-Peptide-binding Protein Involved in Alzheimer's Disease, J. Biol. Chem., 1998, 273(17), 10741–10746, DOI:10.1074/jbc.273.17.10741.
- R. Ofman, J. P. N. Ruiter and M. Feenstra, et al., 2-Methyl-3-Hydroxybutyryl-CoA Dehydrogenase Deficiency Is Caused by Mutations in the HADH2 Gene, Am. J. Hum. Genet., 2003, 72(5), 1300–1307, DOI:10.1086/375116.
- V. Metodieva, T. Smith and F. Gunn-Moore, The Mitochondrial Enzyme 17βHSD10 Modulates Ischemic and Amyloid-β-Induced Stress in Primary Mouse Astrocytes, eNeuro, 2022, 9(5), ENEURO.0040-22.2022, DOI:10.1523/ENEURO.0040-22.2022.
- S. Du Yan, Y. Shi and A. Zhu, et al., Role of ERAB/l-3-Hydroxyacyl-coenzyme A Dehydrogenase Type II Activity in Aβ-induced Cytotoxicity, J. Biol. Chem., 1999, 274(4), 2145–2156, DOI:10.1074/jbc.274.4.2145.
- X. Y. He, G. Merz, P. Mehta, H. Schulz and S. Y. Yang, Human Brain Short Chain l-3-Hydroxyacyl Coenzyme A Dehydrogenase Is a Single-domain Multifunctional Enzyme, J. Biol. Chem., 1999, 274(21), 15014–15019, DOI:10.1074/jbc.274.21.15014.
- X. Y. He, J. Wegiel and S. Y. Yang, Intracellular oxidation of allopregnanolone by human brain type 10 17beta-hydroxysteroid dehydrogenase, Brain Res., 2005, 1040(1), 29–35, DOI:10.1016/j.brainres.2005.01.022.
- J. W. Lustbader, M. Cirilli and C. Lin, et al., ABAD Directly Links Aß to Mitochondrial Toxicity in Alzheimer's Disease, Science, 2004, 304(5669), 448–452, DOI:10.1126/science.1091230.
- K. Rauschenberger, K. Schöler and J. O. Sass, et al., A non-enzymatic function of 17β-hydroxysteroid dehydrogenase type 10 is required for mitochondrial integrity and cell survival, EMBO Mol. Med., 2010, 2(2), 51–62, DOI:10.1002/emmm.200900055.
- L. Torroja, D. Ortuño-Sahagún, A. Ferrús, B. Hämmerle and J. A. Barbas, Scully, an Essential Gene of Drosophila, is Homologous to Mammalian Mitochondrial Type II l-3-hydroxyacyl-CoA Dehydrogenase/Amyloid-β Peptide-binding Protein, J. Cell Biol., 1998, 141(4), 1009–1017, DOI:10.1083/jcb.141.4.1009.
- E. A. Carlson, R. T. Marquez, F. Du, Y. Wang, L. Xu and S. S. Yan, Overexpression of 17β-hydroxysteroid dehydrogenase type 10 increases pheochromocytoma cell growth and resistance to cell death, BMC Cancer, 2015, 15(1), 166, DOI:10.1186/s12885-015-1173-5.
- X. Y. He, G. Merz, P. Mehta, H. Schulz and S. Y. Yang, Human Brain Short Chain l-3-Hydroxyacyl Coenzyme A Dehydrogenase Is a Single-domain Multifunctional Enzyme, J. Biol. Chem., 1999, 274(21), 15014–15019, DOI:10.1074/jbc.274.21.15014.
- J. Zschocke, J. P. N. Ruiter and J. Brand, et al., Progressive Infantile Neurodegeneration Caused by 2-Methyl-3-Hydroxybutyryl-CoA Dehydrogenase Deficiency: A Novel Inborn Error of Branched-Chain Fatty Acid and Isoleucine Metabolism, Pediatr. Res., 2000, 48(6), 852–855, DOI:10.1203/00006450-200012000-00025.
- A. Kobayashi, L. L. Jiang and T. Hashimoto, Two Mitochondrial 3-Hydroxyacyl-CoA Dehydrogenases in Bovine Liver, J. Biochem., 1996, 119(4), 775–782, DOI:10.1093/oxfordjournals.jbchem.a021307.
- S. Y. Yang and X. Y. He, Role of Type 10 17ß-Hydroxysteroid Dehydrogenase in the Pathogenesis of Alzheimer's Disease, Neuropathol. Genet. Dement., 2001, 487, 101–110, DOI:10.1007/978-1-4615-1249-3_8.
- J. Holzmann, P. Frank, E. Löffler, K. L. Bennett, C. Gerner and W. Rossmanith, RNase P without RNA: Identification and Functional Reconstitution of the Human Mitochondrial tRNA Processing Enzyme, Cell, 2008, 135(3), 462–474, DOI:10.1016/j.cell.2008.09.013.
- E. Vilardo and W. Rossmanith, Molecular insights into HSD10 disease: impact of SDR5C1 mutations on the human mitochondrial RNase P complex, Nucleic Acids Res., 2015, 43(10), 5112–5119, DOI:10.1093/nar/gkv408.
- H. Jörnvall, B. Persson, M. Krook, S. Atrian, R. Gonzàlez-Duarte, J. Jeffery and D. Ghosh, Short-Chain DehydrogenasesReductases (SDR), Biochemistry, 1995, 34(18), 6003–6013, DOI:10.1021/bi00018a001.
- Y. Kallberg, U. Oppermann, H. Jörnvall and B. Persson, Short-chain dehydrogenases/reductases (SDRs), Eur. J. Biochem., 2002, 269(18), 4409–4417, DOI:10.1046/j.1432-1033.2002.03130.x.
- L. Vinklarova, M. Schmidt, O. Benek, K. Kuca, F. Gunn-Moore and K. Musilek, Friend or enemy? Review of 17β-HSD10 and its role in human health or disease, J. Neurochem., 2020, 155(3), 231–249, DOI:10.1111/jnc.15027.
- S. H. Korman and S. Y. Yang, HSD17B10 replaces HADH2 as the approved designation for the gene mutated in 2-methyl-3-hydroxybutyryl-CoA dehydrogenase deficiency, Mol. Genet. Metab., 2007, 91(1), 115, DOI:10.1016/j.ymgme.2007.01.001.
- S. Y. Yang, X. Y. He and H. Schulz, Multiple functions of type 10 17β-hydroxysteroid dehydrogenase, Trends Endocrinol. Metab., 2005, 16(4), 167–175, DOI:10.1016/j.tem.2005.03.006.
- K. H. Lu, B. R. Hopper, T. M. Vargo and S. S. C. Yen, Chronological Changes in Sex Steroid, Gonadotropin and Prolactin Secretion in Aging Female Rats Displaying Different Reproductive States1, Biol. Reprod., 1979, 21(1), 193–203, DOI:10.1095/biolreprod21.1.193.
- M. M. McCarthy, Estradiol and the Developing Brain, Physiol. Rev., 2008, 88(1), 91–124, DOI:10.1152/physrev.00010.2007.
- V. N. Luine, Estradiol and cognitive function: Past, present and future, Horm. Behav., 2014, 66(4), 602–618, DOI:10.1016/j.yhbeh.2014.08.011.
- D. Khan and S. Ansar Ahmed, The Immune System Is a Natural Target for Estrogen Action: Opposing Effects of Estrogen in Two Prototypical Autoimmune Diseases, Front. Immunol., 2016, 6, 635, DOI:10.3389/fimmu.2015.00635.
- X. Y. He, C. Dobkin and S. Y. Yang, 17β-Hydroxysteroid dehydrogenases and neurosteroid metabolism in the central nervous system, Mol. Cell. Endocrinol., 2019, 489, 92–97, DOI:10.1016/j.mce.2018.10.002.
- M. D. Majewska, N. L. Harrison, R. D. Schwartz, J. L. Barker and S. M. Paul, Steroid Hormone Metabolites Are Barbiturate-Like Modulators of the GABA Receptor, Science, 1986, 232(4753), 1004–1007, DOI:10.1126/science.2422758.
- X. Y. He, Y. Z. Yang, D. M. Peehl, A. Lauderdale, H. Schulz and S. Y. Yang, Oxidative 3α-hydroxysteroid dehydrogenase activity of human type 10 17β-hydroxysteroid dehydrogenase, J. Steroid Biochem. Mol. Biol., 2003, 87(2), 191–198, DOI:10.1016/j.jsbmb.2003.07.007.
- V. Luu-The, A. Bélanger and F. Labrie, Androgen biosynthetic pathways in the human prostate, Best Pract. Res., Clin. Endocrinol. Metab., 2008, 22(2), 207–221, DOI:10.1016/j.beem.2008.01.008.
- D. Ayan, R. Maltais and D. Poirier, Identification of a 17β-Hydroxysteroid Dehydrogenase Type 10 Steroidal Inhibitor: A Tool to Investigate the Role of Type 10 in Alzheimer's Disease and Prostate Cancer, ChemMedChem, 2012, 7(7), 1181–1184, DOI:10.1002/cmdc.201200129.
- A. Cagnacci, R. Soldani, P. Luigi Carriero, A. Maria Paoletti, P. Fioretti and G. B. Melis, Effects of Low Doses of Transdermal 17β-Estradiol on Carbohydrate Metabolism in Postmenopausal Women, J. Clin. Endocrinlogy Metab., 1996, 74(6), 1396–1400, DOI:10.1210/jcem.74.6.1317387.
- L. R. Nelson and S. E. Bulun, Estrogen production and action, J. Am. Acad. Dermatol., 2001, 45(3, Supplement), S116–S124, DOI:10.1067/mjd.2001.117432.
- S. M. Aronica, W. L. Kraus and B. S. Katzenellenbogen, Estrogen action via the cAMP signaling pathway: stimulation of adenylate cyclase and cAMP-regulated gene transcription, Proc. Natl. Acad. Sci. U. S. A., 1994, 91(18), 8517–8521, DOI:10.1073/pnas.91.18.8517.
- C. B. Wade, S. Robinson, R. A. Shapiro and D. M. Dorsa, Estrogen Receptor (ER)α and ERβ Exhibit Unique Pharmacologic Properties When Coupled to Activation of the Mitogen-Activated Protein Kinase Pathway, Endocrinology, 2001, 142(6), 2336–2342, DOI:10.1210/endo.142.6.8071.
- L. Zhang, D. R. Rubinow and G. Xaing, et al., Estrogen protects against β-amyloid-induced neurotoxicity in rat hippocampal neurons by activation of Akt, NeuroReport, 2001, 12(9), 1919 CrossRef CAS PubMed.
- M. Marino, P. Galluzzo and P. Ascenzi, Estrogen Signaling Multiple Pathways to Impact Gene Transcription, Curr. Genomics, 2006, 7(8), 497–508, DOI:10.2174/138920206779315737.
- M. J. Kelly, R. L. Moss and C. A. Dudley, Differential Sensitivity of Preoptic-Septal Neurons to Microelectrophoresed Estrogen during the Estrous Cycle, Brain Res., 1976, 114, 152–157 CrossRef CAS PubMed.
- A. Maggi, P. Ciana, S. Belcredito and E. Vegeto, Estrogens in the Nervous System: Mechanisms and Nonreproductive Functions, Annu. Rev. Physiol., 2004, 66(1), 291–313, DOI:10.1146/annurev.physiol.66.032802.154945.
- P. E. Micevych and P. G. Mermelstein, Membrane Estrogen Receptors Acting Through Metabotropic Glutamate Receptors: An Emerging Mechanism of Estrogen Action in Brain, Mol. Neurobiol., 2008, 38(1), 66–77, DOI:10.1007/s12035-008-8034-z.
- R. D. Brinton, Estrogen regulation of glucose metabolism and mitochondrial function: Therapeutic implications for prevention of Alzheimer's disease, Adv. Drug Delivery Rev., 2008, 60(13–14), 1504–1511, DOI:10.1016/j.addr.2008.06.003.
- J. W. Simpkins and J. A. Dykens, Mitochondrial mechanisms of estrogen neuroprotection, Brain Res. Rev., 2008, 57(2), 421–430, DOI:10.1016/j.brainresrev.2007.04.007.
- L. Zhao, T. Wu and R. D. Brinton, Estrogen receptor subtypes alpha and beta contribute to neuroprotection and increased Bcl-2 expression in primary hippocampal neurons, Brain Res., 2004, 1010(1–2), 22–34, DOI:10.1016/j.brainres.2004.02.066.
- P. Mannella and R. D. Brinton, Estrogen Receptor Protein Interaction with Phosphatidylinositol 3-Kinase Leads to Activation of Phosphorylated Akt and Extracellular Signal-Regulated Kinase 1/2 in the Same Population of Cortical Neurons: A Unified Mechanism of Estrogen Action, J. Neurosci., 2006, 26(37), 9439–9447, DOI:10.1523/JNEUROSCI.1443-06.2006.
- J. Nilsen, R. W. Irwin, T. K. Gallaher and R. D. Brinton, Estradiol In Vivo Regulation of Brain Mitochondrial Proteome, J. Neurosci., 2007, 27(51), 14069–14077, DOI:10.1523/JNEUROSCI.4391-07.2007.
- J. Nilsen and R. D. Brinton, Mechanism of estrogen-mediated neuroprotection: Regulation of mitochondrial calcium and Bcl-2 expression, Proc. Natl. Acad. Sci. U. S. A., 2003, 100(5), 2842–2847, DOI:10.1073/pnas.0438041100.
- D. P. Srivastava, E. M. Waters, P. G. Mermelstein, E. A. Kramár, T. J. Shors and F. Liu, Rapid Estrogen Signaling in the Brain: Implications for the Fine-Tuning of Neuronal Circuitry, J. Neurosci., 2011, 31(45), 16056–16063, DOI:10.1523/JNEUROSCI.4097-11.2011.
- E. A. Kramár, L. Y. Chen and N. J. Brandon, et al., Cytoskeletal Changes Underlie Estrogen's Acute Effects on Synaptic Transmission and Plasticity, J. Neurosci., 2009, 29(41), 12982–12993, DOI:10.1523/JNEUROSCI.3059-09.2009.
- V. W. Henderson, Estrogen-containing hormone therapy and Alzheimer's disease risk: Understanding discrepant inferences from observational and experimental research, Neuroscience, 2006, 138(3), 1031–1039, DOI:10.1016/j.neuroscience.2005.06.017.
- M. J. Luo, L. F. Mao and H. Schulz, Short-Chain 3-Hydroxy-2-methylacyl-CoA Dehydrogenase from Rat Liver: Purification and Characterization of a Novel Enzyme of Isoleucine Metabolism, Biochem. Biophys., 1995, 32(1), 214–220 CrossRef PubMed.
- D. Nelson and M. Cox, Lehninger Principles of Biochemistry, W.H. Freeman, 7th edn, 2017 Search PubMed.
- D. H. Williamson, M. W. Bates, M. A. Page and H. A. Krebs, Activities of enzymes involved in acetoacetate utilization in adult mammalian tissues, Biochem. J., 1971, 121(1), 41–47, DOI:10.1042/bj1210041.
- A. Dimou, V. Tsimihodimos and E. Bairaktari, The Critical Role of the Branched Chain Amino Acids (BCAAs) Catabolism-Regulating Enzymes, Branched-Chain Aminotransferase (BCAT) and Branched-Chain α-Keto Acid Dehydrogenase (BCKD), in Human Pathophysiology, Int. J. Mol. Sci., 2022, 23(7), 4022, DOI:10.3390/ijms23074022.
- T. Bo and J. Fujii, Primary Roles of Branched Chain Amino Acids (BCAAs) and Their Metabolism in Physiology and Metabolic Disorders, Molecules, 2025, 30(1), 56, DOI:10.3390/molecules30010056.
- S. H. Korman, Inborn errors of isoleucine degradation: A review, Mol. Genet. Metab., 2006, 89(4), 289–299, DOI:10.1016/j.ymgme.2006.07.010.
- M. Doi, I. Yamaoka, M. Nakayama, K. Sugahara and F. Yoshizawa, Hypoglycemic effect of isoleucine involves increased muscle glucose uptake and whole body glucose oxidation and decreased hepatic gluconeogenesis, Am. J. Physiol.: Endocrinol. Metab., 2007, 292(6), E1683–E1693, DOI:10.1152/ajpendo.00609.2006.
- S. C. Larsson, M. Traylor, R. Malik, M. Dichgans, S. Burgess and H. S. Markus, Modifiable pathways in Alzheimer's disease: Mendelian randomisation analysis, BMJ, 2017, 359, j5375, DOI:10.1136/bmj.j5375.
- R. S. Conrad, L. K. Massey and J. R. Sokatch, D and L-Isoleucine Metabolism and Regulation of Their Pathways in Pseudomonas putida, J. Bacteriol., 1974, 118(1), 103–111, DOI:10.1128/jb.118.1.103-111.1974.
- S. Y. Yang, X. Y. He, C. Isaacs, C. Dobkin, D. Miller and M. Philipp, Roles of 17β-hydroxysteroid dehydrogenase type 10 in neurodegenerative disorders, J. Steroid Biochem. Mol. Biol., 2014, 143, 460–472, DOI:10.1016/j.jsbmb.2014.07.001.
- G. Bertolin, M. Jacoupy and S. Traver, et al., Parkin maintains mitochondrial levels of the protective Parkinson's disease-related enzyme 17-β hydroxysteroid dehydrogenase type 10, Cell Death Differ., 2015, 22(10), 1563–1576, DOI:10.1038/cdd.2014.224.
- J. Upadia, N. Walano and G. S. Noh, et al., HSD10 disease in a female: A case report and review of literature, JIMD Rep., 2021, 62(1), 35–43, DOI:10.1002/jmd2.12250.
- A. O. J. Fakoya and I. Abulatan, 17-Beta-Hydroxysteroid Dehydrogenase X Deficiency, Genetic Syndromes, Springer, Cham, 2023, pp. 1–3 DOI:10.1007/978-3-319-66816-1_1717-1.
- R. Kubo, Y. Iwamoto and S. Ajihara, et al., A Case of 17β-Hydroxysteroid Dehydrogenase Type 10 (HSD10) Disease Caused by a Novel Variant Presenting With Rapidly Progressive Cardiomyopathy Triggered by Viral Infection, Cureus, 2025, 17(9), e93552, DOI:10.7759/cureus.93552.
- J. García-Villoria, A. Navarro-Sastre and C. Fons, et al., Study of patients and carriers with 2-methyl-3-hydroxybutyryl-CoA dehydrogenase (MHBD) deficiency: Difficulties in the diagnosis, Clin. Biochem., 2009, 42(1), 27–33, DOI:10.1016/j.clinbiochem.2008.10.006.
- K. C. Chatfield, C. R. Coughlin and M. W. Friederich, et al., Mitochondrial energy failure in HSD10 disease is due to defective mtDNA transcript processing, Mitochondrion, 2015, 21, 1–10, DOI:10.1016/j.mito.2014.12.005.
- K. Tieu, C. Perier and M. Vila, et al., L-3-hydroxyacyl-CoA dehydrogenase II protects in a model of Parkinson's disease, Ann. Neurol., 2004, 56(1), 51–60, DOI:10.1002/ana.20133.
- L. M. Shulman, Understanding disability in Parkinson's disease, Mov. Disord, 2010, 25(S1), S131–S135, DOI:10.1002/mds.22789.
- S. Y. Yang, X. Y. He and S. E. Olpin, et al., Mental retardation linked to mutations in the HSD17B10 gene interfering with neurosteroid and isoleucine metabolism, Proc. Natl. Acad. Sci. U. S. A., 2009, 106(35), 14820–14824, DOI:10.1073/pnas.0902377106.
- V. Jazbutyte, F. Kehl, L. Neyses and T. Pelzer, Estrogen receptor alpha interacts with 17β-hydroxysteroid dehydrogenase type 10 in mitochondria, Biochem. Biophys. Res. Commun., 2009, 384(4), 450–454, DOI:10.1016/j.bbrc.2009.04.139.
- L. Pagani and A. Eckert, Amyloid-Beta Interaction with Mitochondria, Int. J. Alzheimers Dis., 2011, 2011, 925050, DOI:10.4061/2011/925050.
- H. D. Robertson, S. Altman and J. D. Smith, Purification and Properties of a Specific Escherichia coli Ribonuclease which Cleaves a Tyrosine Transfer Ribonucleic Acid Precursor, J. Biol. Chem., 1972, 247(16), 5243–5251, DOI:10.1016/S0021-9258(19)44963-6.
- C. Guerrier-Takada, K. Gardiner, T. Marsh, N. Pace and S. Altman, The RNA moiety of ribonuclease P is the catalytic subunit of the enzyme, Cell, 1983, 35(3, Part 2), 849–857, DOI:10.1016/0092-8674(83)90117-4.
- S. Oerum, M. Roovers and R. P. Rambo, et al., Structural insight into the human mitochondrial tRNA purine N1-methyltransferase and ribonuclease P complexes, J. Biol. Chem., 2018, 293(33), 12862–12876, DOI:10.1074/jbc.RA117.001286.
- M. W. Hentze, Enzymes as RNA-binding proteins: a role for (di)nucleotide-binding domains?, Trends Biochem. Sci., 1994, 19(3), 101–103, DOI:10.1016/0968-0004(94)90198-8.
- A. J. Deutschmann, A. Amberger and C. Zavadil, et al., Mutation or knock-down of 17β-hydroxysteroid dehydrogenase type 10 cause loss of MRPP1 and impaired processing of mitochondrial heavy strand transcripts, Hum. Mol. Genet., 2014, 23(13), 3618–3628, DOI:10.1093/hmg/ddu072.
- E. Vilardo, C. Nachbagauer, A. Buzet, A. Taschner, J. Holzmann and W. Rossmanith, A subcomplex of human mitochondrial RNase P is a bifunctional methyltransferase—extensive moonlighting in mitochondrial tRNA biogenesis, Nucleic Acids Res., 2012, 40(22), 11583–11593, DOI:10.1093/nar/gks910.
- A. Schubert and S. Grimm, Cyclophilin D, a Component of the Permeability Transition-Pore, Is an Apoptosis Repressor, Cancer Res., 2004, 64(1), 85–93, DOI:10.1158/0008-5472.CAN-03-0476.
- C. R. Kissinger, P. A. Rejto and L. A. Pelletier, et al., Crystal Structure of Human ABAD/HSD10 with a Bound Inhibitor: Implications for Design of Alzheimer's Disease Therapeutics, J. Mol. Biol., 2004, 342(3), 943–952, DOI:10.1016/j.jmb.2004.07.071.
- M. Hanzlova, B. Slavikova and M. Morozovova, et al., C-3 Steroidal Hemiesters as Inhibitors of 17β-Hydroxysteroid Dehydrogenase Type 10, ACS Omega, 2024, 9(10), 12116–12124, DOI:10.1021/acsomega.3c10148.
- A. Grimm, K. Schmitt, U. E. Lang, A. G. Mensah-Nyagan and A. Eckert, Improvement of neuronal bioenergetics by neurosteroids: Implications for age-related neurodegenerative disorders, Biochim. Biophys. Acta, Mol. Basis Dis., 2014, 1842(12, Part A), 2427–2438, DOI:10.1016/j.bbadis.2014.09.013.
- A. Grimm, E. E. Biliouris, U. E. Lang, J. Götz, A. G. Mensah-Nyagan and A. Eckert, Sex hormone-related neurosteroids differentially rescue bioenergetic deficits induced by amyloid-β or hyperphosphorylated tau protein, Cell. Mol. Life Sci., 2016, 73(1), 201–215, DOI:10.1007/s00018-015-1988-x.
- A. Houfková, M. Schmidt and O. Benek, et al., New insights into the 17β-hydroxysteroid dehydrogenase type 10 and amyloid-β 42 derived cytotoxicity relevant to Alzheimer's disease, Alzheimers Res. Ther., 2025, 17(1), 170, DOI:10.1186/s13195-025-01821-8.
- A. N. I. Viswanath, T. Kim, S. Y. Jung, S. M. Lim and A. N. Pae, In silico-designed novel non-peptidic ABAD LD hot spot mimetics reverse Aβ-induced mitochondrial impairments in vitro, Chem. Biol. Drug Des., 2017, 90(6), 1041–1055, DOI:10.1111/cbdd.13065.
- K. Takuma, J. Yao and J. Huang, et al., ABAD enhances Aβ-induced cell stress via mitochondrial dysfunction, FASEB J., 2005, 19(6), 1–25, DOI:10.1096/fj.04-2582fje.
- L. Aitken, G. Baillie and A. Pannifer, et al., High-Throughput Screening of Potent Drug-like Molecules Targeting 17β-HSD10 for the Treatment of Alzheimer's Disease and Cancer, ACS Chem. Biol., 2025, 20(7), 1544–1559, DOI:10.1021/acschembio.5c00110.
- J. Yao, H. Du and S. Yan, et al., Inhibition of Amyloid-β (Aβ) Peptide-Binding Alcohol Dehydrogenase-Aβ Interaction Reduces Aβ Accumulation and Improves Mitochondrial Function in a Mouse Model of Alzheimer's Disease, J. Neurosci., 2011, 31(6), 2313–2320, DOI:10.1523/JNEUROSCI.4717-10.2011.
- X. Yang, Y. Yang, J. Wu and J. Zhu, Stable Expression of a Novel Fusion Peptide of Thioredoxin-1 and ABAD-Inhibiting Peptide Protects PC12 Cells from Intracellular Amyloid-Beta, J. Mol. Neurosci., 2007, 33(2), 180–188, DOI:10.1007/s12031-007-0063-y.
- T. Ali, A. N. Klein, A. Vu, M. I. Arifin, S. Hannaoui and S. Gilch, Peptide aptamer targeting Aβ–PrP–Fyn axis reduces Alzheimer's disease pathologies in 5XFAD transgenic mouse model, Cell. Mol. Life Sci., 2023, 80(6), 139, DOI:10.1007/s00018-023-04785-w.
- L. Hroch, O. Benek and P. Guest, et al., Design, synthesis and in vitro evaluation of benzothiazole-based ureas as potential ABAD/17β-HSD10 modulators for Alzheimer's disease treatment, Bioorg. Med. Chem. Lett., 2016, 26(15), 3675–3678, DOI:10.1016/j.bmcl.2016.05.087.
- L. Aitken, O. Benek and B. E. McKelvie, et al., Novel Benzothiazole-Based Ureas as 17β-HSD10 Inhibitors, A Potential Alzheimer's Disease Treatment, Molecules, 2019, 24(15), 2757, DOI:10.3390/molecules24152757.
- C. S. W. Law and K. Y. Yeong, Current trends of benzothiazoles in drug discovery: a patent review (2015–2020, Expert Opin. Ther. Pat., 2022, 32(3), 299–315, DOI:10.1080/13543776.2022.2026327.
- Y. Xie, S. Deng, Z. Chen, S. Yan and D. W. Landry, Identification of small-molecule inhibitors of the Aβ–ABAD interaction, Bioorg. Med. Chem. Lett., 2006, 16(17), 4657–4660, DOI:10.1016/j.bmcl.2006.05.099.
- O. Benek, M. Vaskova and M. Miskerikova, et al., Development of submicromolar 17β-HSD10 inhibitors and their in vitro and in vivo evaluation, Eur. J. Med. Chem., 2023, 258, 115593, DOI:10.1016/j.ejmech.2023.115593.
- A. Morsy, K. Maddeboina and J. Gao, et al., Functionalized Allopurinols Targeting Amyloid-Binding Alcohol Dehydrogenase Rescue Aβ-Induced Mitochondrial Dysfunction, ACS Chem. Neurosci., 2022, 13(14), 2176–2190, DOI:10.1021/acschemneuro.2c00246.
- A. T. Marques, P. A. Fernandes and M. J. Ramos, Molecular dynamics simulations of the amyloid-beta binding alcohol dehydrogenase (ABAD) enzyme, Bioorg. Med. Chem., 2008, 16(21), 9511–9518, DOI:10.1016/j.bmc.2008.09.043.
- Y. A. Lim, A. Grimm and M. Giese, et al., Inhibition of the Mitochondrial Enzyme ABAD Restores the Amyloid-β-Mediated Deregulation of Estradiol, PLoS One, 2011, 6(12), e28887, DOI:10.1371/journal.pone.0028887.
- S. Daria, D. Kumar and N. Gautam, et al., In vitro ADME, mouse pharmacokinetics of LD14b, and bioanalysis of a novel aβ 17β-HSD10 modulator for the treatment of Alzheimer's disease, Xenobiotica, 2024, 54(9), 711–722, DOI:10.1080/00498254.2024.2402033.
- W. Geissler, D. Davis, W. Ling, et al., Male pseudohermaphroditism caused by mutations of testicular 17∼-hydroxysteroid dehydrogenase 3, Published online 1994 DOI:10.1038/ng0594-34.
- C. A. Heinlein and C. Chang, Androgen Receptor in Prostate Cancer, Endocr. Rev., 2004, 25(2), 276–308, DOI:10.1210/er.2002-0032.
- S. Boutin, J. Roy, R. Maltais, W. Alata, F. Calon and D. Poirier, Identification of steroidal derivatives inhibiting the transformations of allopregnanolone and estradiol by 17β-hydroxysteroid dehydrogenase type 10, Bioorg. Med. Chem. Lett., 2018, 28(22), 3554–3559, DOI:10.1016/j.bmcl.2018.09.031.
- S. Boutin, R. Maltais, J. Roy and D. Poirier, Synthesis of 17β-hydroxysteroid dehydrogenase type 10 steroidal inhibitors: Selectivity, metabolic stability and enhanced potency, Eur. J. Med. Chem., 2021, 209, 112909, DOI:10.1016/j.ejmech.2020.112909.
- Y. Hua, X. Dai and Y. Xu, et al., Drug repositioning: Progress and challenges in drug discovery for various diseases, Eur. J. Med. Chem., 2022, 234, 114239, DOI:10.1016/j.ejmech.2022.114239.
- R. Marder and R. C. Meibach, Risperidone in the Treatment of Schizophrenia. Published online 1994 DOI:10.1176/ajp.151.6.825.
- M. Sajatovic, M. Subramoniam and M. A. Fuller, Risperidone in the treatment of bipolar mania, Neuropsychiatr. Dis. Treat., 2006, 2(2), 127–138, DOI:10.2147/nedt.2006.2.2.127.
- S. J. Dilly, A. J. Clark and A. Marsh, et al., A chemical genomics approach to drug reprofiling in oncology: Antipsychotic drug risperidone as a potential adenocarcinoma treatment, Cancer Lett., 2017, 393, 16–21, DOI:10.1016/j.canlet.2017.01.042.
- L. Aitken, G. Baillie and A. Pannifer, et al., In Vitro Assay Development and HTS of Small-Molecule Human ABAD/17β-HSD10 Inhibitors as Therapeutics in Alzheimer's Disease, SLAS Discovery, 2017, 22(6), 676–685, DOI:10.1177/2472555217697964.
- L. F. Dow, R. Pathirage, H. E. Erickson, E. Amani, D. R. Ronning and P. C. Trippier, Synthesis and biological characterization of a 17β hydroxysteroid dehydrogenase type 10 (17β-HSD10) inhibitor, RSC Med. Chem., 2025, 16(2), 862–875, 10.1039/D4MD00733F.
- L. Aitken, G. Baillie and A. Pannifer, et al., In Vitro Assay Development and HTS of Small-Molecule Human ABAD/17β-HSD10 Inhibitors as Therapeutics in Alzheimer's Disease, SLAS Discovery, 2017, 22(6), 676–685, DOI:10.1177/2472555217697964.
|
| This journal is © The Royal Society of Chemistry 2026 |
Click here to see how this site uses Cookies. View our privacy policy here.