Tzu-Cheng
Sung‡
a,
Ting
Wang‡
a,
Qian
Liu‡
a,
Qing-Dong
Ling
b,
Suresh Kumar
Subbiah
c,
Remya Rajan
Renuka
c,
Shih-Tien
Hsu
d,
Akihiro
Umezawa
e and
Akon
Higuchi
*afg
aState Key Laboratory of Ophthalmology, Optometry and Visual Science, Eye Hospital, Wenzhou Medical University, No. 270, Xueyuan Road, Wenzhou, Zhejiang 325027, China. E-mail: higuchi@wmu.edu.cn; Fax: +86-577-88824115; Tel: +86-577-88824116
bCathay Medical Research Institute, Cathay General Hospital, No. 32, Ln 160, Jian-Cheng Road, Hsi-Chi City, Taipei 221, Taiwan
cCentre for Materials Engineering and Regenerative Medicine, Bharath Institute of Higher Education and Research, 173, Agaram Road, Tambaram East, Chennai-73, 600078, India
dDepartment of Internal Medicine, Taiwan Landseed Hospital, 77 Kuangtai Road, Pingjen City, Tao-Yuan County 32405, Taiwan
eDepartment of Reproduction, National Center for Child Health and Development, 2-10-1 Okura, Setagaya-ku, Tokyo, 157-8535, Japan
fDepartment of Chemical and Materials Engineering, National Central University, No. 300, Jhongda RD., Jhongli, Taoyuan 32001, Taiwan. E-mail: higuchi@ncu.edu.tw; Fax: +886-3-2804271; Tel: +886-4227151-34257
gR & D Center for Membrane Technology, Chung Yuan Christian University, 200 Chung-Bei Rd., Jhongli, Taoyuan 320, Taiwan
First published on 2nd February 2023
Human cells, especially stem cells, need to communicate and interact with extracellular matrix (ECM) proteins, which not only serve as structural components but also guide and support cell fate and properties such as cell adhesion, proliferation, survival and differentiation. The binding of the cells with ECM proteins or ECM-derived peptides via cell adhesion receptors such as integrins activates several signaling pathways that determine the cell fate, morphological change, proliferation and differentiation. The development of synthetic ECM protein-derived peptides that mimic the biological and biochemical functions of natural ECM proteins will benefit academic and clinical application. Peptides derived from or inspired by specific ECM proteins can act as agonists of each ECM protein receptor. Given that most ECM proteins function in cell adhesion via integrin receptors, many peptides have been developed that bind to specific integrin receptors. In this review, we discuss the peptide sequence, immobilization design, reaction method, and functions of several ECM protein-derived peptides. Various peptide sequences derived from mainly ECM proteins, which are used for coating or grafting on dishes, scaffolds, hydrogels, implants or nanofibers, have been developed to improve the adhesion, proliferation or differentiation of stem cells and to culture differentiated cells. This review article will help to inform the optimal choice of ECM protein-derived peptides for the development of scaffolds, implants, hydrogels, nanofibers and 2D cell culture dishes to regulate the proliferation and direct the differentiation of stem cells into specific lineages.
Typically, xenogenic or allogenic ECM molecules are immobilized on tissue culture polystyrene (TCP) flasks and several types of scaffolds, hydrogels, implants or nanofibers for adhesion, proliferation, and differentiation of adult stem cells and pluripotent stem cells as well as cells from other tissues. For example, hPSCs can be cultured on Matrigel or Geltrex matrices and recombinant vitronectin or laminin-coated surfaces. Matrigel is derived from mouse Engelbreth–Holm–Swarm sarcomas, and the main components of Matrigel are laminin-111 (laminin-1), laminin-511 (laminin-10) and laminin-332 (laminin-5), collagen and heparan sulfate proteoglycans.60,61
Among ECM proteins, laminin and recombinant laminin molecules are very unique ECM proteins compared to other ECM proteins, which are typically used for coating or grafting on TCP dishes, scaffolds, hydrogels, implants and nanofibers to culture hPSCs, NPSCs, hPSC-derived neural cells (including neurons)62,63 and hPSC-derived cardiomyocytes;64–68 on collagen- or fibronectin-coated dishes, where hPSCs easily differentiate and/or poorly proliferate.69,70
Laminins are high molecular weight proteins (approximately 400–900 kDa) with heterotrimeric chains composed of α-, β- and γ-chains (Fig. 1), which have five, four, and three genetic variants, respectively.71–73 The laminin molecules are named according to their heterotrimeric chain composition. Laminin-111 (laminin-1) is composed of α1, β1, and γ1 chains; laminin-511 (laminin-10) consists of α5, β1, and γ1 chains;74,75 laminin-332 (laminin-5) is composed of α3, β3, and γ2 chains;76,77 and laminin-521 (laminin-11) contains α5, β2, and γ1 chains.78–80
Although xenogenic or allogenic ECM proteins such as native or recombinant laminin molecules are valuable for the culture of hPSCs, hPSC-derived cells and primary cells, ECM proteins should be produced from human cell lines or E. coli, which makes it difficult to chemically define the molecules mixed with ECM proteins after production. The current ECM protein production method cannot avoid the contamination risk of immunogens and pathogens.1 Furthermore, there exists lot-to-lot variation in ECM proteins. The development of synthetic ECM protein-derived peptides that mimic the biological and biochemical functions of natural ECMs should be beneficial for academic and clinical application.1,81–86 Peptides derived from or inspired by specific ECM proteins can work as agonists of each ECM protein receptor. Considering that most ECM proteins influence cell adhesion via integrin receptors, many peptides have been developed that bind to specific integrin receptors. In this study, we discuss several peptides, including laminin-derived peptides, for their peptide sequence, immobilization design and reaction method as well as their functions. Various peptide sequences derived from mainly ECM protein molecules, which are used for coating or grafting on dishes, scaffolds, hydrogels, implants or nanofibers for adhesion, proliferation or differentiation of stem cells and their differentiated cells, are summarized in Tables S1,1,72,87–114 S286,88,94,98,105 S383,97,98,108,115–124 and S4 (ESI†).86,100,101,110,125–136 The peptides derived from growth factors are also summarized in Table S5 (ESI†).105,137–144
Fig. 3 shows analytical results of integrin expression and ECM protein expression in hPSCs (H9, HES3, and RiPSCs), hPSC-derived neural progenitor cells (hPSC-derived hNPCs), hPSC-derived endoderm cells (hPSC-ENs), hPSC-derived mesoderm cells (hPSC-MEs), and hPSC-derived ectoderm cells (hPSC-ECs), which were investigated by Varun et al.98 hPSCs express most of the integrin α chain except integrin α8 and express the integrin β chain. Once hPSCs differentiated into the cell-derived endoderm, mesoderm and ectoderm, the differentiated cells expressed fewer integrins than the hPSCs did, except integrin α8 (Fig. 3). Integrin α8 is not expressed in hPSCs, hPSC-derived endoderm cells or hPSC-derived mesoderm cells but is strongly expressed in hPSC-derived ectoderm cells and moderately expressed in hPSC-derived hNPCs. The integrin α8 expression in hPSC-derived hNPCs, which are ectoderm cells, is not completely the same as that in hPSC-derived ectoderm cells, although there are some similarities in integrin expression between both cell types.98 The expression difference of integrins in the cells before and after the differentiation of hPSCs can be used for purification of hPSC-differentiated cells from hPSCs on biomaterials immobilized with specific ECM proteins or ECM protein-derived peptides, a method which can serve as cell sorting dishes66 or for cell affinity chromatography.152 In Fig. 3, the expression of several ECM genes in hPSCs and hPSC-derived cells, including hNPCs, is shown. Laminin (LN in Fig. 3) expression is higher than vitronectin (VTN) or fibronectin (FN1) expression on hNPCs, which corresponds to hNPCs preferably attached and cultured on laminin-coated dishes compared to vitronectin-coated dishes or fibronectin-coated dishes.153,154 The expression levels of ECM proteins and integrin helps to determine which ECM peptides should be immobilized on dishes, nanofibers, hydrogels, implants or scaffolds to be used for specific stem cells and differentiation protocols.
![]() | ||
Fig. 3 The expression of lineage markers (A), ECM proteins (B) and integrins (ITG) (C) in hPSCs and hPSC-derived endoderm (EN), mesoderm (ME) and ectoderm (EC) cells analyzed by a quantitative PCR assay. Each data point is illustrated in a heatmap, where black indicates the minimum expression of each gene and red corresponds to the maximum level of each gene. The gene expression levels were normalized to the sample with the highest expression level. Modified from ref. 98, Copyright 2016, Elsevier Ltd. |
It is necessary to design peptides that target specific integrins for adhesion, proliferation and differentiation of hPSCs and hNPCs. Typically, most researchers graft simple and short RGD peptides onto their polymeric materials to enhance cell adhesion.145,155–158 Various integrin receptors can bind to RGD, such as α3β1, α5β1, αvβ1, αMβ2, αIIIbβ3, αvβ3, and αvβ5. Specific cells, such as hPSCs or hNSCs, cannot attach to polymeric materials, which are generally grafted with simple RGD peptides. For example, a long sequence containing the RGD peptide KGGPQVTRGDVFTMP is necessary to bind to hPSCs via αvβ5,68,94,98,159–164 which mimics vitronectin for hPSC adhesion and proliferation. Another RGD peptide, PMQKMRGDVFSP, binds to hPSCs via α6β1,68,88 which mimics the laminin β4 chain for hPSC adhesion and proliferation. Furthermore, the cell adhesion of specific cells depends on the peptide designs, including whether or not RGD is present. Therefore, specific cell binding with high adhesion potential depends on the presence or absence of RGD sequences.
![]() | ||
Fig. 4 Evolutionarily conserved motif analysis of laminin-derived RGD peptides from species in the Euarchonglires group. (A) Schematic illustration of the species in Euarchontoglires for conserved motif analysis of laminin-derived RGD peptides. (B) Motif analysis of the highly conserved sequences among Euarchonglires species. Dashed-line boxes from the plots indicate the highly conserved positions around RGD. The repetitions of each amino acid is indicated by the size of the letter. Reproduced from ref. 87 under a Creative Commons Attribution NonCommercial License 4.0. |
They evaluated these peptides obtained from the analysis of evolutionary conservation of peptide sequences around the RGD motif for human endothelial cell (human umbilical vein endothelial cell, HUVEC) adhesion on the microarrays of hydrogels prepared with methacrylated peptides and GGGG (G; glycine) as a joint segment. The methacrylated peptides are mixed with polyethylene glycol (PEG) diacrylate and the mixed solution was spotted and polymerized under UV light to generate microarrays spotted with the hydrogels grafted with these peptides.87 The hydrogels containing the α1-1 peptide showed better HUVEC attachment than the hydrogels containing other sequences of the peptides. The hydrogels containing α1-1 peptide promoted better vascular network formation of HUVECs compared to the hydrogels containing β4 peptide (RGDVFSPPGMVHG) as well as the hydrogels containing A99 (QAGTFALRGDNOQG) and PA26 (FALRGDNP) peptides, which are laminin-derived peptides reported previously. The therapeutic effect of the injectable alginate hydrogels containing α1-1 peptides with and without MMPQK (a site that is degradable by matrix metalloproteinase (MMP) enzymes) on vascular network formation was evaluated using hindlimb ischemia mice, where the MMPQK peptide promotes ECM cleavage and facilitates remodeling of ECM networks, which is important for tissue regeneration.87 Extensive enhancement in blood restoration in the hindlimb ischemia mice (60% recovery by day 28) was observed by injection of the hydrogels containing α1-1 and MMPQK peptides compared to the injection of the hydrogels containing α1-1 peptides only or the hydrogels containing RGDS and MMPQK peptides; interestingly, the hydrogels containing RGDS and MMPQK peptides have been widely reported to promote vascular network formation.165–167 Significant enhancement of artery and capillary blood vessel formation and a decrease in muscle degeneration and fibrotic area were observed in hindlimb ischemia mice injected with hydrogels containing α1-1 and MMPQK peptides.87
The superior characteristics of endothelial cell adhesion and vascular formation potential of the α1-1 peptide may be explained as α1-1 peptides allow integrin receptors to not only target laminin but also fibronectin. It has also been found that some long sequences of peptides containing RGD are necessary to generate specific and unique functions of specific cell adhesion and tissue regeneration. For example, the α1-1 (GTFALRGDNP) peptide contains 10 amino acids, whereas the simple RGD peptide contains only 3 amino acids. Peptides with long sequences likely fix specific stereo structures (3D conformations), whereas single peptide chains, such as RGD, have flexible structures and cannot fit into specific integrin receptors with high affinity. Some interesting future work would be to evaluate an evolutionarily conserved peptide sequence containing RGD (and other small integrin binding peptides) using not only laminin chains such as laminin α3, α4, α5, β1, β4, γ1, γ2 and γ3 chains but also other ECM proteins such as fibronectin and vitronectin.
In this method, the bacteria were genetically modified to express green fluorescence protein (GFP) and CPX protein fused with short peptide sequences, where the short peptide sequences were a variety of linear 15-mer sequences (X15, where X is any amino acid) or a variety of cyclized 7-mer sequences of the form of X2CX7CX2 (where X is any amino acid), depending on the bacteria,60 where cysteine (C) molecules in the sequence bind to each other to generate a cyclic peptide. The process of untargeted selection, which does not target the α6 integrin receptor but targets any receptors on hESCs (H1), proceeds in four cycles. After binding of the bacteria to hESCs, the bacteria-bound hESCs were isolated, and the selected bacteria that can bind to hESCs were cultured and expanded (Fig. 5A).60 These processes were repeated four times. In the subsequent targeted peptide selections for α6 integrin receptor, hESCs were first treated with the blocking antibody for α6 integrin subunit (Fig. 5B).60 Then, the antibody-blocked hESCs were coincubated with the bacterial library, which was selected in the previous untargeted selections. The unbound bacteria in the supernatant were collected (negative selection) and incubated (Fig. 5B). Finally, the peptides expressing the unbound bacteria were analyzed.60 Three cyclic peptides, 7C-1, 7C-2 and 7C-12, and one linear sequence, 15-23, which have highly selective binding to the α6 integrin of hESCs, were selected for further analysis; peptides 7C-1 and 7C-2 contained an RGD-like moiety, DGR. The identified peptides, which are summarized in Table S8 (ESI†), could bind to the α6 integrin receptor of hPSCs with a sub-μM dissociation constant, which is the same order of magnitude as the dissociation constant of laminin.60
![]() | ||
Fig. 5 Untargeted and targeted screening for hPSC-binding peptides. (A) Untargeted screening for hPSC binding peptides. The bacterial display scheme is utilized to determine novel hPSC-binding peptides. The bacterial libraries are (1) cultured and (2) induced to express alajGFP and a unique peptide variant on the bacterial surface. Each peptide, fused to the N-terminus of the circularly permuted outer membrane protein (inset), can interact with specific integrin receptors on the hPSC surface. Panning is performed by (3) incubating peptide-expressing bacteria with hPSCs, (4) allowing for binding events to occur and (5) eliminating unbound clones. (B) Targeted screening for integrin-binding peptides. The bacterial display scheme utilized to identify peptides that bind hPSCs via specific integrins. Bacterial libraries are sequentially panned against two target hPSCs: (1) hPSCs with the target receptor blocked by antibodies, which ablate receptor binding (negative selection), and (2) unblocked hPSCs (positive selection). Bacterial clones, which cannot bind the target during negative selection but bind during positive selection, are considered to have specific integrin specificity. Copyright 2021. Adapted from ref. 60 with permission from the American Chemical Society. |
hESCs adhered to the surface immobilized with cyclic peptides 7C-1, 7C-2 and 7C-12 with an 80–90% adhesion rate and showed stronger hESC adhesion on the surface immobilized with the linear peptide, 15–23.60 This is because cyclic peptides lose their conformational entropy, which leads to enhanced fitting between the peptide and the integrin receptor. In particular, hESCs on the surface immobilized with 7C-1 showed higher adhesion than those on the surface immobilized with other cyclic peptides (7C-2 and 7C-12) or the liner peptide (15–23) and expressed the pluripotent protein of Oct3/4 on levels comparable to cells on dishes coated with Matrigel (a gold standard material for hPSC culture). It should be noted that hESCs can adhere to peptide-immobilized surfaces with even a very dilute peptide density (28 pmol cm−2). However, the density of immobilized bioactive peptides on synthetic material surfaces should be greater than or equal to 600 pmol cm−2 for hESC cultures to attain a proliferation speed similar to that of hESCs cultured on Matrigel-coated dishes.
The cyclic peptide 7C-1, which was found to be the best peptide for hPSC culture in the study, was conjugated with alkanethiol, and self-assembled monolayers (SAMs) were prepared on gold-coated plates.60 SAM surfaces were prepared using not only 7C-1 peptides but also alkanethiol-conjugated bspRGD(15), which has integrin- and glycosaminoglycan-binding motifs (a 15-amino-acid ligand for αVβ3-integrin), and alkanetiol-conjugated Ag73, which is a syndecan-1 and β1-integrin binding peptide. The hiPSCs cultured on the SAM surface prepared with a mix of three peptides (20% cyclic 7C-1, 40% bspRGD(15), and 40% Ag73 peptides) showed much better characteristics than any SAM surface coated with only one or two peptides.60 This is because the SAM surface coated with three peptides activates not only α6-integrin but also other surface receptors to facilitate hiPSC adhesion. However, the maximum culture period of the study was a single 5 days passage. It is necessary to evaluate more long-term culture (e.g., >10 passages) of several hiPSC and hESC lines on a triple-peptide-grafted surface to evaluate the capacities of the three peptides as binding sites of hPSC in their proliferation. However, the idea to use multiple ECM protein-derived peptides, which target multiple integrin receptors, might be useful for future hPSC culture and differentiation into specific lineages of cells on biomaterials immobilized with multiple ECM protein-derived peptides.
The peptides should be immobilized on 2D or 3D materials for adhesion, culture, proliferation, and differentiation of primary cells, stem cells and progenitor cells. To do so, the peptides are covalently immobilized (peptide-conjugation method) or are adsorbed (peptide-coating method) on cell culture materials. In most cases, peptides are covalently conjugated on cell culture materials such as TCP plates, polymeric films, gold-coated materials, nanofibers, implants, scaffolds and hydrogels. The coating method of the peptides and the chemical reaction of the immobilization of peptides on 2D and 3D materials are discussed in the following section.
Puah et al. designed peptides by combining the bioactive peptide site from ECM proteins, including laminin-derived peptides YIGSR and IKVAV (Table S1, ESI†).92 The combined peptides (YIGSRWYQNMIRIKVAV, QHREDGSYIGSRIKVAV, WQPPRARIYIGSRIKVAV, DGEARGDSPKRSR) (Fig. 6) were coated on multilayer graphene oxide (mGO) with a relatively low coating concentration of the combined peptide solution (50 μM, or 105 μg mL−1 for YIGSRWYQNMIRIKVAV).92 This is because the combined peptides contain 3–4 positively charged amino acids and 0–3 aromatic amino acids on each combined peptide, which contribute to peptide attachment to the mGO surface by electrostatic forces and π–π interactions. Wharton's Jelly-derived mesenchymal stem cells (WJ-MSCs) showed better proliferation and facilitated osteogenic differentiation on peptide-coated mGO surfaces compared to native mGO surfaces.92 The combined peptide was effective in facilitating a high proliferation and desired differentiation direction of WJ-MSCs. However, it would have been more valuable to compare the combined peptides to the mixture of peptides (from which the combined peptides are derived) from a single active site and with similar molecular weight (Fig. 6). With such a comparison, the effect of the multiple bioactive sites of the combined peptides on WJ-MSC proliferation and differentiation could be clarified. Furthermore, a joint segment (GG, GGG or GGGG) might be necessary between each bioactive site in the peptides (Fig. 6). For example, the peptides DGEAGGRGDSPGGKRSR or DGEAGGGGRGDSPGGGGKRSR might be more effective in guiding the proliferation and differentiation of WJ-MSCs than the original peptide DGEARGDSPKRSR.
![]() | ||
Fig. 6 The combined peptide sequences with and without a joint segment (GGGG), which are derived from laminin. |
Varun et al. investigated the expression of ECM proteins and integrin in hPSCs, hPSC-derived endoderm, mesoderm and ectoderm cells, and hNPCs, as described previously (Fig. 3).98 From these data, they designed 18 peptides derived from bioactive sites of laminin α1 (5 peptides), laminin β1 (1 peptide), laminin γ1 (4 peptides), vitronectin (2 peptides), fibronectin (4 peptides), and collagen (1 peptide), as described in Tables S1, S2 and S7 (ESI†). Only four peptide-coated dishes supported hNPC adhesion and proliferation for 3 days of culture; the hNPCs coated on the peptide-coated dishes showed similar characteristics (cell morphology and cell numbers) to hNPCs on laminin-coated dishes. The four favorable peptides are (a) CGGTWYKIAFQRNRK (laminin α1-derived peptide), which binds to integrin α6β1 and α2β1; (b) CDIRVTLNRL (laminin γ1-derived peptide), which binds to integrin α6β1; (c) CKGGPQVTRGDVFTMP (vitronectin-derived peptide), which binds to integrin αvβ5 and α5β1; and (d) CGKKQRFRHRNRKG (vitronectin-derived peptide, HBP-1C), which binds to integrin αvβ5.98
The four selected peptides were further investigated to determine whether hNPCs can be cultured on the peptide-coated dishes for a long time (up to 10 passages). hNPCs can expand on vitronectin-derived peptide (CGKKQRFRHRNRKG)-coated dishes (HBP-1C-coated dishes) with less differentiation and similar morphologies to hNPCs cultured on laminin-coated dishes. Furthermore, hNPCs can differentiate into neuronal cells in HBP-1C-coated dishes in neuronal differentiation medium. Several neuronal markers, such as β3-tubulin, microtubule-associated protein 2 (MAP2), neurofilament-68 (NF-L), and γ-aminobutyric acid (GABA), were expressed similarly in the cells derived from hNPCs cultured on HBP-1C-coated dishes and on laminin-coated dishes. Therefore, the authors concluded that the vitronectin-derived peptide CGKKQRFRHRNRKG is effective as a coating material for hNPC culture and proliferation and differentiation into neurons.
However, it should be noted that the minimum concentration of the peptide (CGKKQRFRHRNRKG) coating solution that they used was 100 μM, corresponding to 177.1 μg mL−1, whereas the concentration of laminin coating solution was 5 μg mL−1. This result indicates that the concentration of the peptide solution should be 35 times higher than that of the ECM protein solution to receive these results.
Hennesy et al. prepared collagen I mimetic peptide (DGEA, P15 (GTPGPQIAGQAGVV), and GFOGER))-coated hydroxyapatite disks using 1000 μg mL−1 peptide solution to investigate human bone marrow stem cell (hBMSC) attachment and differentiation into osteoblasts.173 hBMSCs adhered better and showed more efficient differentiation into osteoblasts on hydroxyapatite disks coated with DGEA and P15 compared to uncoated hydroxyapatite disks or disks coated with GFOGER.173
It is known that stem cells cultured on tissue-specific ECM can differentiate into specific tissue cells with high efficiency.187–196 Therefore, Dorgau et al. prepared decellularized ECM peptides from the neural retina and retinal pigment epithelium (RPE) of adult bovine eyes by using surfactant treatment.187 They generated rod photoreceptors with high efficiency from hPSCs using decellularized ECM peptides in the differentiated medium. Furthermore, the addition of decellularized ECM peptides to the differentiation medium led to the enhancement of ribbon synapses and light-responsive retinal organoids. Although decellularized ECM peptides derived from specific tissues are promising bioactive agents for controlling cell differentiation, decellularized ECM peptides are not chemically defined, and it is expected that many different types of peptides (with and without modification of several types of glycosaminoglycans) exist in the decellularized ECM peptides. Identifying the peptides that most effectively guide hPSCs into rod photoreceptors and light-responsive retinal organoids would be valuable in regenerative therapy of eye disease.
![]() | ||
Fig. 7 The genetically engineered peptides derived from laminin, p20 (RNIAEIIKDI) and RGD with elastin-like peptide. |
A similar design of the engineered peptides was developed by several researchers.175,176 For example, Truong et al. developed the engineered peptide (A99-ELP-R), which contains laminin α1 chain-derived peptide (A99, AGTFALRGDNPQG) and elastin-like peptide ((VPGIG)30) with a GMG joint segment (Fig. 7).175 Lee et al. engineered globular domains 1–3 of laminin α5 with fusion to ELP,176 an engineered peptide that should be called a protein because of its high molecular weight (70 kDa). The TCP dishes coated with 1 μg mL−1 of the engineered peptide (protein) could support hMSC adhesion with favorable stem cell characteristics.
Lee et al. designed a peptide combined with two different peptide domains: one peptide is bone morphogenetic protein-2 (BMP-2) domain, KIPKACCVPTELSAISMLYL, and the other peptide is hydroxyapatite-binding domain. The engineered peptide is inspired by N-terminal osteocalcin having an α-helix structure and sequences of the form γEPRRγEVAγEL, γEPRRAVAAL, EPRREVAEL and EPRRAVAAL (Table S9, ESI†),177 where γE is γ-carboxylated glutamic acid. The original N-terminal osteocalcin domain, γEPRRγEVCγEL, is modified with (i) alanine (A) instead of cysteine (C) and (ii) glutamic acid (E) or alanine (A) instead of γE in some peptides, which may affect whether the α-helix structure is more or less stable compared to the original N-terminal osteocalcin domain. The sequence of four continuous alanine residues, AAAA, was used as a joint segment between two different peptide domains, which contributes to the α-helix structure. A hydroxyapatite layer grown on poly(lactide-co-glycolide) (PLGA) films was coated with the designed peptides eBGa3 (KIPASSVPTELSAISTLYL-AAA-γEPRRγEVCγEL), eBGA1 (KIPASSVPTELSAISTLYL-AAA-γEPRRAVAAL), eBGu3 (KIPASSVPTELSAISTLYL-AAA-EPRREVAEL) and eBGu1 (KIPASSVPTELSAISTLYL-AAA-EPRRAVAAL) with a 100 μg mL−1 peptide solution.177 Chemical schemes of base polymeric materials for coating or grafting ECM protein-derived peptides discussed in this review are shown in Fig. 8.
The saturated adsorbed amount of the peptides depended on the modified peptide of N-terminal osteocalcin. The amount of the peptide bound on the hydroxyapatite grown on the PLGA surface was in the following order: eBGa3 ≫ eBGa1 > > eBGu1 = eBGu1 ≫ KIPASSVPTELSAISTLYL.177 Similar to the saturated adsorption amount of the peptides, the peptides released from the hydroxyapatite formed on PLGA films in aqueous solution. The peptide eBGa3 was released slowly (only 16% release after 70 days), whereas the peptides eBGu1 and eBGu3 were released much faster (more than 93% was released after 5 days).177 These results indicate that γEPRRγEVAγEL in eBGa3 generates the most stable α-helix structure. The hydroxyapatite (formed on PGLA film) coated with eBGa3 promoted the efficient differentiation of hBMSCs into osteoblasts in the osteogenic medium. Osteogenic differentiation of hBMSCs was highest on hydroxyapatite (formed on PGLA film) coated with eBGa3 than that of hBMSCs coated on TCP dishes or hydroxyapatite (formed on PGLA film) without a coating or with a coating of other peptides.177
Studying the combination of different functional peptides with joint segments, such as the combination of anchoring peptides and bioactive peptides with joint segments, should be useful to develop sophisticated bioactive peptides as coating materials.
Another type of peptide design having a combination of two different functional peptides is EEEEEEERGD, which was developed by Sawyer et al. (Table S9, ESI†), where E7 was designed to enhance the anchorage of the peptides by ionic interaction with the hydroxyapatite biomaterial surface.178 The hydroxyapatite, which was precoated with a low concentration of EEEEEEERGD (1–10 μg mL−1), was subsequently coated with 100% FBS and promoted hBMSC adhesion and spreading compared to the hydroxyapatite sequentially coated with RGD and FBS (without the pretreatment of EEEEEEERGD). Compared to culture on EEEEEEERGD-coated hydroxyapatite, the introduction of a joint segment such as GGGG in the coating peptide (resulting in EEEEEEE-GGGG-RGD-coated hydroxyapatite) may improve hBMSC adhesion, spreading and differentiation characteristics.
Sawyer et al. used two peptide coatings to improve hBMSC attachment and spreading on hydroxyapatite for bone regeneration.174 The peptide coatings contain unnatural amino acids: one is a linear peptide of GRGDdSP (D-serine (dS) is used), and the other is a cyclic peptide of G(Pen)GRGDSPCA, where (Pen) indicates penicillamine; a thiol group in the penicillamine and a thiol group in serine are conjugated to make a cyclic peptide in the G(Pen)GRGDSPCA peptide (Fig. 9). The coating of GRGDdSP or G(Pen)GRGDSPCA alone on the hydroxyapatite surface is not enough to promote cell attachment and spreading.174 hBMSCs extensively attached and spread on hydroxyapatite when the surface was precoat with low peptide concentrations, such as 1 or 10 μg mL−1, and subsequently coated with 100% fetal bovine serum (FBS). Interestingly, a high concentration of peptide precoating (100 or 1000 μg mL−1) inhibited cell attachment on the hydroxyapatite surface prepared with the peptide/FBS coating.174 This finding can be explained as follows: GRGDdSP binds to the binding site (integrin receptor) of fibronectin, and G(Pen)GRGDSPCA binds to the binding site of vitronectin. Too high of a single peptide density on the surface will inhibit the usage of other binding sites of ECM proteins and glycosaminoglycan or generate free peptides in the culture medium. The free peptides are released from the hydroxyapatite surface, working as inhibitors of the cell binding on the hydroxyapatite surface. This is likely the reason that GRGDdSP was used instead of GRGDSP (all amino acids are L-isomers) to reduce the binding of the free peptide on hBMSCs as an inhibitor. He et al. also reported that titanium (Ti) implants coated with the LL-37 peptide ([LL-37, 37 aa]), a cationic antimicrobial peptide; the medium (50 μg mL−1) or low (5 μg mL−1) concentration of the peptide promoted rat BMSC expansion and viability, while the high concentration (100 μg mL−1) did not.129 Therefore, the covalent binding of the bioactive peptides on cell culture materials is important to prevent the bioactive peptides from being released and acting as inhibitors (Fig. 10).
There was no significant difference in the usage of GRGDdSP and G(Pen)GRGDSPCA peptides for hBMSC attachment and spreading. If hPSCs were used instead of hBMSCs, hPSC attachment and proliferation might show more distinct differences for different peptide coatings, especially for comparison of single peptide-coated surface and mixed peptide-coated surface, allowing better evaluation of the peptides.
Vida et al. prepared polyamidoamine RGD peptide-conjugated dendrimers (Fig. 11),183 which were coated on PS dishes for hBMSC culture; (RGDC)8-polyamidoamine dendrimer and polyamidoamine dendrimer-(CRGD)8 were used in the study. hBMSCs on the dishes coated with (RGDC)8-polyamidoamine dendrimer adhered better and proliferated more extensively than those cultured on the dishes coated with polyamidoamine dendrimer-(CRGD)8.183 If the joint segment of GG, GGG or GGGG were to be introduced between RGD peptide and polyamidoamine and if RGDSP and not RGD is selected as a bioactive peptide (e.g., (RGDSP-GGGG-C)8-polyamidoamine dendrimer), the cell adhesion and differentiation might be improved from what was observed in the study.
Yang et al. designed a clickable mussel-inspired peptide (3,4-dihydroxy-L-phenylalanine-polyethylene glycol-azide ((DOPA)4-PEG5-azide)) using polydopamine,198 where clickable mussel-inspired peptides were conjugated on the hydroxy group of a titanium oxide (TiO2)-coated stainless stent surface using mussel-inspired adhesion (Fig. 12). Subsequently, NO-generating organoselenium (dibenzylcyclooctyne (DBCO)-SeCA) and DBCO-conjugated endothelial progenitor cell (EPC)-binding peptide, TPSLEQRTVYAL, (TPS-DBCO, DBCO-capped EPC-binding peptide) were clicked onto the TiO2-coated stent surface conjugated with the clickable mussel-inspired peptide using biorthogonal conjugation (Fig. 12).198 The engineered stent surface had excellent inhibition of thrombosis, which may be caused by the NO-generating organoselenium site, and excellent promotion of EPC recruitment and proliferation, which may be due to the EPC-binding peptide on the engineered stent surface.198 These results are interesting; however, some skill of organic synthesis is necessary to prepare (DOPA)4-PEG5-azide, dibenzylcyclooctyne (DBCO)-SeCA and TPS-DBCO and apply the design to other biomaterials.
![]() | ||
Fig. 12 Clickable mussel-inspired peptides conjugated on titanium oxide-coated stainless stent surface using mussel-inspired adhesion. (A) Chemical scheme of the clickable mussel-inspired peptide ((DOPA)4-PEG5-Azide), NO-generating organoselenium ((DBCO)-SeCA) and RPC-binding peptide (TPS-DBCO). (B) Surface cografting on representative vascular stents through mussel-inspired coordinative interactions and biorthogonal click chemistry. Copyright 2020. Adapted with permission from PNAS. Reproduced from ref. 198 under a Creative Commons Attribution. |
Tatrai et al. synthesized a branched polymer of poly[Lys(Ser0.9-DL-Ala2.7) grafted with cyclic RGD (Fig. 13),185 which could be coated on TCP dishes and titanium alloy used for surgical implants and natural bone substitutes, termed “Bio-Oss”, used in dental clinics. Human ADSCs could adhere to and proliferate on the cyclic peptide-grafted polymer-coated surface efficiently and extensively differentiated into osteoblasts on the coated surface in the differentiation medium.185 To thoroughly evaluate the effect of cyclic RGD, a branched polymer of poly[Lys(Ser0.9-DL-Ala2.7) grafted with not only cyclic RGD (cyclo(RGDfC)) peptide but also linear RGD peptide such as RGD, RGDS, and RGDSP should be synthesized. However, the usage of a coating peptide material containing cyclic RGD peptide is expected to enhance cell attachment, proliferation and differentiation of the stem cells.
Hayashi et al. prepared peptide-conjugated bovine serum albumin (BSA) as a coating material where peptides were derived from laminin-111 sequences (AG73, RKRLQVQLSIRT; C16, KAFDITYVRLKF; A99, AGTFALRGDNPQG; AG10, NRWHSIYITRFG; and EF1XmR, RLQLQEGRLHFXFD, where X = Nle) and the thiol–maleimide click reaction was used for the conjugation of peptides and BSA (the reaction is discussed in more detail in the following section).89 NPSCs can efficiently differentiate into neurons and astrocytes on TCP dishes coated with AG73 or C16 peptide-conjugated BSA. In particular, TCP dishes coated with C16 peptide-conjugated BSA facilitated the expression of neuronal markers, such as syntaxin 1A and synaptosomal-associated protein-25.89
Glycidyl methacrylate (GMA) is typically used to introduce epoxy functional groups on material surfaces (Fig. 14). Higuchi et al. polymerized GMA on PS dishes or polyurethane foaming membranes where the epoxy group was generated on the surface of the dishes and membranes.206–208 Subsequently, the amine group or peptide could be conjugated on the surface with the reaction of the deoxy group and ammonia or amine group of the peptide (CS1, EILDVPST) in aqueous solution for human hematopoietic stem cell (HSC) culture.209 Furthermore, methacrylated peptides can be prepared by reacting the amino groups of peptides and GMA.
Epoxy groups can also be introduced using diethylene glycol diglycidyl ether (DGDE) (Fig. 14), which has epoxy groups on both ends and can react with a variety of functional groups.210 However, DGDE has the same reactive epoxy group on both ends. Subsequently, there is the possibility of a reaction occurring between two groups on the material surface or between peptides. The reaction using DGDE contains several side reactions. Therefore, it is not generally recommended to use DGDE to conjugate material surfaces and peptides.
The primary amine of peptides can also react with acryloyl choloride in dry alcohol, which generates acrylated peptides (Fig. 14). Gao et al. printed acrylated peptides (GRGDS and GCRDGPQGIWGQDRCG [MMP-sensitive peptide]) and PEGDA using inkjet printing (bioprinting) for bone and cartilage tissue formation with hMSCs.204 Similar to acrylyl chloride, the primary amine of peptides can react with N-acryloxysuccinimide (Fig. 14) in N,N-dimethylformamide (DMF) to generate acrylated peptides.211
The azide group can be introduced on the peptide using sulfosuccinimidyl-6-[4′azido-2′-nitrophenylamino]hexanoate (sulfo-SANPAH) in aqueous solution (Fig. 14).212,213 Azide groups on peptides can react with amino groups or alkenes (vinyl groups) on material surfaces or biomolecules (Fig. 14).
Furthermore, the amine group of the peptides can be reacted with NHS-PEG-maleimide (Fig. 14) to introduce a maleimide group on the peptide. The maleimide group can further react with the thiol group on the materials (maleimide–thiol reaction). Succinimidyl-4-(p-maleimidophenyl)butylate (SMPB) is similar to NHS-PEG-maleimide, but phenylbutylate is introduced between NHS and maleimide instead of a flexible and biocompatible PEG segment (Fig. 14). N-Succinimidyl-3-maleimidopropionate (SMP) also has NHS and maleimide on each of its ends (Fig. 14), which can be used in DMF.214
N-(p-maleimidophenyl)isocyanate (PMPI, NCO-maleimide) has isocyanate on one end and a maleimide group on the other end (Fig. 14). PMPI can react with the hydroxy end group of PEG on the block copolymer of PS and PEG in DMF to introduce a maleimide group on the copolymer.215 Subsequently, cysteine-containing peptides were conjugated using a maleimide–thiol reaction (Michael-type addition).
Maleimide groups can also be introduced on peptides using maleimidopropionic acid from a conjugation of primary amine and propionic acid in dichloromethane by carbodiimide chemistry.216
PEG-succinimidyl 3-(2-pyridyldithio)propionate (PEG-SPDP), typically PEG4-SPDP and PEG12-SPDP, and N-succinimidyl-3-(2-pyridyldithiol) propionate (SPDP)217 work similarly to NHS-PEG-maleimide. PEG-SPDP (used in aqueous solution) and SPDP (used in DMF or dimethyl sulfoxide (DMSO)) (Fig. 14) react with the amine group of the peptides and can introduce a suflhydryl-reactive 2-pyridyldithiol group, which can bind to cysteine-containing peptides or thiol group-conjugated materials and molecules.
Dibenzylcyclooctyne-maleimide (DBCO-MAL) (Fig. 14) efficiently incorporates DBCO groups onto cysteine-containing peptides and material surfaces or other thiol-containing molecules and material surfaces.198 The maleimide group reacts with sulfhydryl (thiol) groups such as cysteine to form stable thioether bonds. DBCO can conjugate with an azide group, which does not require cytotoxic Cu(I) catalyst (copper-free click reaction).
N3-PEG5-COOH can introduce azido groups on peptides or material surfaces.198 For example, the primary amine can be conjugated with the carboxylic acid of N3-PEG5COOH using carbodiimide chemistry in aqueous solution.
The above reaction can also be used on the material surface to introduce functional groups on the materials. Typically, the material surfaces are activated by introducing NHS-PEG-maleimide, SMPB, PEG-SPDP, sulfo-SANPAH, and cysteine-introduced peptide on the activated material surface (thiol–ene reaction).218 Most researchers use NHS-PEG-maleimide in the thiol–ene reaction.219,220 These reactions can be performed in aqueous solution. Therefore, these reactions are nontoxic and do not damage the peptides and material surfaces in general.
Maleimide-streptavidin can introduce cysteine-conjugated peptides or thiol-containing materials using a maleimide–thiol reaction (Michael-type addition). Furthermore, biotinylation of the peptides or materials can be performed using a biotin–protein ligase kit in aqueous solution.221 Biotin–avidin (streptavidin) binding can contribute to the conjugation of peptides on the material surface.
2,2,2-Trifluoroethanesulfonyl chloride (tresyl chloride) (Fig. 14) can react with hydroxy groups, such as glass plates, and introduce a tresyl group.222,223 The activated surface can react with the primary amine of the peptides, where the peptides are covalently bonded on the material surface with hydroxy groups.
![]() | ||
Fig. 15 Reaction combination among functional groups located on peptides and biomaterial or biopolymer surface. |
Biodegradable polymers that can be conjugated with bioactive peptides and used for stem cell culture and differentiation include poly-L-lactide (PLLA), PLGA, chitosan, carboxymethyl chitosan, alginate, hyaluronic acid (HyA), polycaprolactone (PCL) and poly-(3-hydroxybutyrate-co-3-hydroxyvalerate); these polymers can be used to generate nanofibers, scaffolds and hydrogels (Fig. 8). Nonbiodegradable polymers, such as PS, poly(N-isopropylacrylamide), polyhydroxyethlmethacrylate (polyHEMA), polyacrylate, polyacrylamide and polyurethane, are also used as polymeric films, dishes, scaffolds and hydrogels for stem cell culture and differentiation (Fig. 8). These material surfaces may or may not have functional groups to react with peptides. When the material surface does not have appropriate functional groups, the functional groups are introduced by physical treatment, such as ozone treatment from γ-ray irradiation and plasma treatment, or chemical treatment, such as hydrolysis. Copolymerization with a small portion of monomer-containing functional side chains is also useful for the preparation of synthetic materials. When the materials have some functional groups, such as hydroxy groups, carboxylic acid groups or amino groups, a variety of other functional groups, such as alkene (vinyl) groups, alkynes, sulfhydryl (thiol) groups, epoxy groups, isocyanate groups, azido groups, and maleimide groups, can be introduced using reactions similar to those described above.
In the following sections, the reaction among these functional groups on peptides and material surfaces (biomolecules) will be discussed in more detail. Fig. 16 shows the summary of reactions of bioactive peptides grafted onto a material surface using several different reaction methods. Fig. 17 shows the probabilities of each grafting reaction on the grafting of peptides on the biomaterials; this information is summarized in Table S10 (ESI†).
![]() | ||
Fig. 17 Percentage of each reaction for peptide-grafting on biomaterials analyzed from the literature from January 2010 to April 2022. |
The expected reaction scheme of EDC/NHS and EDC/sulfo-NHS chemistry is shown in Fig. 18. Carbodiimidazole (CDI)104 and dicyclohexylcarbodiimide (DCC)165,248,249 can work similarly to EDC. However, the EDC reaction with and without NHS or sulfo-NHS is a popular reaction for the conjugation between the primary amine and carboxylic acid. EDC and carbodiimide can conjugate carboxylic acid with only the primary amine group,250 but the addition of NHS or sulfo-NHS into the EDC reaction solution enhances the reaction efficiency. Therefore, most recent studies have used EDC together with NHS or sulfo-NHS to conjugate peptides on material surfaces or biomacromolecules. Among studies published from January 2010 to April 2022 using immobilization reactions of bioactive peptides on materials, 30% used the EDC/NHS reaction, 10% used the EDC/sulfo-NHS reaction, and only 4% used EDC (previously called water soluble carbodiimide) or DCC only (see Fig. 17 and Table S10, ESI†). Because this reaction can be performed in aqueous solution, it is one of the most common reactions to graft peptides on material surfaces or biomacromolecules.
![]() | ||
Fig. 18 Carbodiimide reaction scheme using EDC/NHS and EDC/sulfo-NHS for peptide grafting on biomaterials containing carboxylic acid. |
Acrylated or methacrylated hydrogels can be prepared using copolymerization of acrylated or methacrylated monomers such as polyethyleneglycol tetraacrylate (PEGTA),1,255 PEGDA,256 polyethylene glycol dimethacrylate (PEGDM),126 and methacrylic anhydride.257 Song et al. prepared acrylated HyA using acryloxysuccinimide (Fig. 14).258 Jiang et al. used vinylsulfone-functionalized polyvinyl alcohol hydrogels (Fig. 8).150 Acrylated poly-(L-lactide) (PLL) or poly(lactic-co-glycolic acid) (PLGA), can be prepared by partial hydrolysis of these biodegradable polyesters and subsequent reaction with acryloyl chloride.130 The polymerization can be performed by photoirradiation, radical polymerization126 or multithiol molecules such as PEG dithiol255 and four-arm thiolated PEG.1
Then, an aqueous solution of the peptides containing cysteine (where cysteine is typically added on the N end of the peptides) is added into the acrylated or methacrylated hydrogels or polymers for the conjugation of peptides on the hydrogels using the thiol–ene reaction (Michael-type addition) (Fig. 19). This reaction is also called the click reaction and is highly efficient. Dhillon et al. also conjugated the IKVAV peptide (CSRARKQAASIKVAVSADR) on N-methacrylate glycol chitosan hydrogels using a thiol–ene reaction.211 Park et al. prepared the BMP peptide KIPKASSVPTELSAISTLYL, where a cysteamide residue (–SH) was conjugated and the BMP peptide was conjugated to gelatin methacrylate using a thiol–ene reaction.259 Several other studies have also demonstrated peptide-conjugated materials using a thiol–ene reaction.128,255,260
Bilem et al. conjugated the BMP-2 (CKIPKASSVPTELSAISMLYL) peptide and RGD (CG-K(PEG3-TAMRA (5-carboxytetramethylrhodamine))-GGRGDS) peptide on borosilicate glass slides using the following process.261,262 The glass slides were aminated by treatment with 3-aminopropyltriethoxysilane (APTES) solution. Then, the aminated glass surface was treated with SMPB solution (Fig. 14) for the conjugation of the maleimide group on the glass slide. Subsequently, maleimide-functionalized glass slides were immersed in cysteine-containing peptides to conjugate peptides onto the glass slides.261,262
Seidlitis et al. prepared thiolated HyA hydrogels from 4-arm PEG-maleimide and thiolated HyA, which were prepared from cystamine conjugation on HyA using carbodiimide chemistry, by Michael-type addition (maleimide–thiol reaction).90 Before gelation of the hydrogels, cysteine-containing peptides (GCGYGRGDSPG, GCGYGIKVAVADR and GCGYGYIGSR) were added to the solution to generate peptide-conjugated HyA hydrogels.90
Li et al. prepared maleimide-functionalized poly(carbonate ester) by copolymerization of furan-maleimide-functionalized trimethylene carbonate and L-lactide, and subsequently, maleimide-functionalized poly(carbonate ester) was obtained by the retro Diels–Alder reaction263,264 (Fig. 16) of furan-maleimide-functionalized poly(carbonate ester).265 The cysteine-conjugated peptide CEPLQLKM (E7, BMSC affinity peptide) was added and conjugated to the maleimide-functionalized poly(carbonate ester) in DMF solution using the maleimide–thiol reaction (Michael-type addition).
Ratcliffe et al. used maleimide-conjugated cyclo-arginine-glycine-aspartate (c-RGD) for the conjugation of c-RGD to the thiol group of thiol–acrylate emulsion-templated porous polymers.266
Several other researchers also used maleimide-functionalized materials (or peptides) to conjugate cysteine-conjugated peptides (or thiol-containing materials) using a maleimide–thiol reaction (Michael-type addition).117,214,215,267,268
Jia et al. prepared methacrylated peptides using methacryloyl chloride and made peptide-functionalized hydrogels by copolymerization of several types of methacrylated peptides and PEDGA.87,88 Similar peptide-functionalized hydrogels have been prepared in several other studies using different types of monomer-conjugated or unconjugated peptides.204,205,211
In several studies, bioactive peptides have been conjugated to biomaterials using the CuAAC reaction (Fig. 20(B) and Table S10, ESI†).227,270 Hudalla and Murphy prepared SAMs on a gold surface where azide-terminated hexaethylene glycol alkanethiolates and carboxylic acid-terminated hexaethylene glycol alkanethiolates were conjugated using a Au–sulfur reaction.227 Using NHS/EDC chemistry, TYRSRKY, which is a heparin sulfate proteoglycan-mediated adhesion peptide for hBMSCs, was conjugated to carboxylic acid-terminated hexaethylene glycol alkanethiolates, whereas acetylene-conjugated RGDSP was conjugated to azide-terminated hexaethylene glycol alkanethiolates in a solution containing CuBr, sodium ascorbate and tris[(1-benzyl-1H-1,2,3-triazol-4-yl)methyl]amine (TBTA) using the CuAAC click reaction (Fig. 20(B)).227 In the study, two different types of bioactive peptides, TYRSRKY and RGDSP, were conjugated on the terminated side of alkanethiolates.
Dvorakova et al. designed injectable hydrogels based on poly(α-amino acid)s conjugated with a bioactive peptide (RGDSGGGY).270 First, poly(N5-(2-hydroxyethyl)-L-glutamine) derivatives with tyramine units (PHEG-Tyr) were prepared. Then, azidoacetic-(CH2CH2O)6RGDSGGGY-NH2 was conjugated on the propargylated units of PHEG-Tyr from the CuAAC click reaction (Fig. 20(B)) in a solution containing sodium ascorbate and the Cu-THPTA complex.270 One of the drawbacks of the CuAAC reaction is that the Cu catalyst might contaminate the final product of the reaction.
![]() | ||
Fig. 22 Design and sequence of peptides grafted onto hydrogels. Single chains (BSP, PVA-VN1, and HBP1), single chains with a joint segment (VN-4G), dual chains (VN-2C and HBP-2C), and branch-type (BOP-1) peptides were conjugated to PVA–IA hydrogels. BSP, VN1, VN-4G, VN-2C, and BOP-1 have an integrin-binding domain, whereas HBP1 and HBP-2C have a glycosaminoglycan-binding domain. Modified from ref. 161 under a Creative Commons Attribution. |
hESCs could attach to the peptide-grafted PVA–IA hydrogels in the chemically defined medium Essential 8, where the hydrogels were prepared with peptides containing the integrin-binding site RGD (BSP-1, VN-1, VN-4G, VN-2C, and BOP-1).161 However, the PVA–IA hydrogels prepared with peptides of heparin-binding proteins (glycosaminoglycan, GAG, binding domain), such as HBP-1 and HBP-2C, could not support hESC adhesion and proliferation. Considering the results of Klim et al.,225 cell culture surfaces containing GAG binding domains could not support hPSC adhesion and proliferation without cyclic RGD peptide immobilization. hESCs cultured on the peptide-grafted PVA–IA hydrogels that have a joint segment, which are prepared from VN-4G and VN-2C, expand faster than hESCs cultured on the hydrogels prepared with a peptide without a joint segment (VN-1).161 Furthermore, the peptide-grafted PVA–IA hydrogels prepared from a peptide that has a dual chain motif (VN-2C) support a higher proliferation speed of hESCs and hiPSCs than the hydrogels prepared with other peptides in chemically defined Essential 8 medium do.161 Therefore, the design of peptides containing an adequate joint segment and a dual chain structure is valuable. The hESCs and hiPSCs after 10 passages of culture showed excellent pluripotent protein expression and high differentiation ability into cells derived from three germ layers in vitro (embryoid body formation assay) and in vivo (teratoma formation assay).
Jia et al. investigated the length of the linker (glycine numbers) between methacrylated-PEGDA hydrogels and a bioactive peptide (RGDSP).88 They conjugated the peptide with (a) no glycine linker, (b) 2 glycine linkers, (c) 4 glycine linkers and (d) 6 glycine linkers. They evaluated hADSC attachment on these hydrogels. hADSCs could attach more effectively to peptide-grafted hydrogels with longer linkers, such as 4 glycine and 6 glycine, than hydrogels with zero or 2 glycine linkers.88 This is because of the enhanced moving flexibility of the peptides to find integrin receptors on the cells. Furthermore, there was no significant difference in the number of hADSCs attached to peptide-grafted hydrogels with 4 glycine linkers and 6 glycine linkers.88 Therefore, they concluded that 4 glycine linkers ensure sufficient exposure of peptide moieties to the cells.
One of the most typical methods to conjugate bioactive peptides on polymeric materials is to conjugate the bioactive peptides with the carboxylic acid group of the material surface using carbodiimide reactions such as EDC/NHS chemistry (Fig. 14, 17 and 18). Higuchi et al. prepared PVA–IA hydrogels on TCPS dishes. Several bioactive peptides were conjugated to the PVA–IA hydrogels using EDC/NHS chemistry.68,161,164 PVA–IA hydrogels grafted with a peptide derived from laminin-β4 (PMQKMRGDVFSP) containing a joint segment (GGGG), dual chain motif (GCGG) and cationic amino acid insertion (KGG) facilitated hPSC attachment and promoted excellent expansion in long-term culture (over 10 passages) with low differentiation rates. However, hPSCs attached weakly to PVA–IA hydrogels conjugated with laminin-α5 peptides (PASYRGDSC), which had joint segments with and without a cationic amino acid (GGGGKGGPASYRGDSC, GCGGKGGPASYRGDSC, and GGGGPASYRGDSC), or to PVA–IA hydrogels conjugated with laminin-β4 peptides containing the joint segment only. The addition of a cationic amino acid (KGG) to the laminin-β4 peptide (GGGGKGGPMQKMRGDVFSP and GCGGKGGPMQKMRGDVFSP) was valuable for hPSC adhesion to PVA–IA hydrogels, contributing to the zeta potential shifting to higher values (3–4 mV increase). Better hPSC proliferation was seen with the novel peptide segment-conjugated PVA–IA hydrogels facilitated than with recombinant VTN-coated plates (a well-established standard for hPSC culture) in xeno-free culture conditions. After long-term culture on peptide-grafted hydrogels, hPSCs differentiated into specific lineages of cells, such as cardiomyocytes, with extensive efficiency.
Gao et al. prepared an acrylated peptide using the reaction between GRGDS or MMP-sensitive peptide and acryloyl chloride.204 The solution of PEGDMA, acrylated GRGDS and acrylated MMP-sensitive peptide together with a photoinitiator (I-2959) was mixed with hBMSCs, and then the PEG-peptide solution was bioprinted using a 3D bioprinting platform. hBMSCs in the PEG-peptide scaffolds extensively enhanced osteogenic and chondrogenic differentiation for bone and cartilage formation.204
The alginate (Fig. 8) solution can be solidified by the addition of divalent cations such as Ca2+ or Mg2+. Alginate hydrogels conjugated with peptides can be prepared as follows. Jia et al. prepared oxidized alginate, which was conjugated with peptide by CuAAC click chemistry.87 The peptide-conjugated alginate solution was injected into Ca2+-containing gelatin dishes to generate peptide-conjugated alginate hydrogels. The attachment of HUVECs to peptide-conjugated alginate hydrogels was then investigated.
Simmons et al. prepared peptide-conjugated alginate using EDC/NHS chemistry.241 The peptide-conjugated alginate, rat BMSCs, and growth factors (BMP-2 and transforming growth factor-β3 (TGF-β3)) were mixed, and the alginate-BMSC solution was cross-linked with calcium sulfate to generate hydrogels conjugated with bioactive peptides and entrapping rat BMSCs.
Luo et al. designed dual peptide-loaded alginate hydrogels for hMSC proliferation and differentiation,246 where an RGD peptide (GGGGRGDASSP) contributes to cell adhesion and proliferation and bone forming peptide-1 (BFP-1, GQGFSYPYKAVFSTQ) contributes to hMSC differentiation into osteoblasts. The authors prepared BFP-1-loaded mesoporous silica nanoparticles (MSNs). Then, the RGD peptide was conjugated to the carboxylic acid of alginate using EDC/Sulfo-NHS chemistry. BFP-1-loaded MSNs were mixed with RGD peptide-conjugated alginate and subsequently crosslinked to generate BFP-1-loaded MSN/RGD peptide-conjugated alginate hydrogels with a calcium sulfate slurry.246 This study indicated that sequential stimulation by the RGD peptide and osteogenic induction by the BFP-1 peptide could synergistically promote cell adhesion, survival, proliferation and osteogenic differentiation compared to the cells treated with a single peptide or simultaneous stimulation.
In several other studies,124,242–245,282,283 peptide-conjugated alginate (Fig. 8) was prepared using an EDC/NHS solution (Fig. 18) or other carbodiimide reaction solutions where the peptide-conjugated alginate solution was inserted or printed on Ca2+-containing gelatin film on the dishes or injected into Ca2+ solution, which generated peptide-conjugated hydrogels on the dishes, because the alginate solution can be crosslinked in the presence of divalent cations such as Ca2+.
Salinas et al. prepared PEG hydrogels conjugated with bioactive peptides using a photoinitiated thiol–acrylate reaction (Fig. 19).256 hBMSCs were suspended in PEGDA and the peptide together with a photoinitiator, 4-(2-hydroxyethoxy)phenyl-(2-hydroxy-2-propyl)ketone. Subsequently, the suspension was irradiated under light at 365 nm with 5 mW cm−2 for 10 min at room temperature.256 The hBMSCs entrapped in the PEG hydrogels conjugated with peptides having a glycine spacer (a joint segment), CGGGGGGGGRGDSG, showed a better survival rate than those in the PEG hydrogels conjugated with peptides without a glycine spacer (CRGDSG or CRGDSCG).256 Although light irradiation with 5 mW cm−2 for 10 min is relatively strong (irradiation with a typical laser pointer of 1–5 mW) for the cells, the cells can be easily entrapped into PEG hydrogels using the photoinitiated thiol–acrylate reaction.
Nguyen et al. also prepared PEG hydrogels using a thiol–ene reaction. Twenty kilodalton 8-arm PEG-norbornene was prepared from the reaction of 8-arm PEG-OH and norbornene using a carbodiimide N,N′-dicyclohexylcarbodiimide (Fig. 23).165 The bioactive CRGDS was conjugated with PEG-norbornene with a photoinitiator (Irgacure 2959) under 365 nm UV light for 3 min at 4.5 mW cm−2. Subsequently, the CRGDS-conjugated PEG-norbornene, PEG-norbornene, MMP (matrix metalloproteinase)-degradable peptide (KCGGPQGIWGQGCK), and PEG-dithiol (HS-PEG-SH) crosslinker were polymerized to generate CRGDS and MMP-conjugated PEG hydrogels.165 The proliferation and capillary network formation of HUVECs cultured on several types of CRGDS and MMP-conjugated PEG hydrogels were then investigated.
Silva prepared GRGDS-conjugated gellan gum hydrogels216 where the glucuronic acid monosaccharide of gellan gum hydrogels is activated with 4-(4,6-dimethoxy-1,3,5-triazin-2-yl)-4-methylmorpholinium chloride (DMT-MM), and subsequently, furfurylamine was conjugated on the gellan gum hydrogels. Then, the furan-gellan gam hydrogels were reacted with maleimide-conjugated GRGDS peptide to generate GRGDS-gellan gum hydrogels using Diels–Alder chemistry, where a maleimide-conjugated GRGDS peptide was synthesized from the reaction with GRGDS, maleimidopropionic acid and diisopropylcarbodiimide.216 GRGDS-gellan gum hydrogels supported the proliferation of rat NPSCs.216 The introduction of a joint segment (GG or GGGG) between the bioactive GRGDS and gellan gum hydrogel might significantly improve the NPSC attachment, proliferation and differentiation observed in the study.
Tam et al. prepared hyaluronan-methyl cellulose hydrogels conjugated with bioactive peptides and growth factors where methyl cellulose was chemically converted to carboxylated-methyl cellulose.221 Then, sulfhydryl-methylcellulose was prepared from the carboxylated-methyl cellulose using 4-(4,6-dimethoxy-1,3,5-triazin-2-yl)-4-methylmorpholinium chloride (DMT-MM), 3,3′-dithiobis(propionic acid dihydrazide), and dithiothreitol. Subsequently, maleimide-streptavidin and maleimide-GRGDS were added to sulfhydryl-methylcellulose to generate GRGDS- and streptavidin-conjugated methylcellulose using the thiol–maleimide click reaction (Fig. 19).221 Furthermore, recombinant platelet-derived growth factor A (rPDGF-A) was conjugated into GRGDS- and streptavidin-conjugated methylcellulose after rPDGF-A was conjugated with biotin. Finally, GRGDS- and rPDGF-A-conjugated methyl cellulose and hyaluronan were blended for their experiments.221 Improved differentiation of rat NPSCs into oligodendrocytes was observed in hydrogels conjugated with GRGDS and rPDGF-A compared to the hydrogels without conjugation of GRGDS and rPDGF-A.
Li et al. prepared PEG hydrogels conjugated with a short laminin peptide (CCRRIKVAVWLC), where four-arm thiolated PEG was crosslinked by PEG tetraacrylate and partially conjugated with the peptide.1 The acrylate in PEG tetraacrylate conjugated with the thiol group of four-arm thiolated PEG and the peptide from the thiol–ene reaction (Michael-type addition reaction). Human NSPCs could attach and proliferate on PEG hydrogels conjugated with the short laminin peptide and efficiently differentiated into neurons on the hydrogels.1
Zhang prepared injectable hydroxyethylmethacrylate (HEMA)-g-poly(L-lactic acid) (HEMA-PLLA) nanofibrous hollow microspheres257 where growth factor mimicking peptides (TGF-β1-mimicking peptide (Cytomodulin-10, LIANAK) and bone morphogenic protein-2 (BMP-2) mimicking peptide (P24, KIPKASSVPTELSAISTLYLSGGC)) are grafted using the click reaction (thiol–ene reaction) (Fig. 19) of thiol from cysteine-bioactive peptide conjugate and alkene from acrylate grafting on HEMA-PLLA nanofibrous microspheres. The acrylic HEMA-PLLA nanofibrous microspheres were prepared by the reaction of methacrylic anhydride with hydroxy groups of HEMA-PLLA nanofibrous microspheres.257 Hyaline cartilage was effectively formed in nude mice by subcutaneous implantation of rabbit BMSCs with cytomodulin-10-grafted HEMA-PLLA nanofibrous hollow microspheres, whereas bone regeneration was clearly observed in nude mice by subcutaneous implantation of rabbit BMSCs with P24-grafted HEMA-PLLA nanofibrous hollow microspheres.257 The growth factor-mimicking peptides, which were grafted with optimal nanofibrous hollow microspheres, work effectively to direct stem cell differentiation for specific tissue regeneration.
HyA is one of the components of the ECM, and HyA hydrogels have anti-inflammatory effects and inhibitory effects on glial scar formation in the central nervous system. Although HyA can bind the cell receptor CD44, the binding ability of HyA to the cells is not sufficient. Therefore, Li et al. introduced the laminin-5 α3 chain-derived peptide PPFLMLLKGSTR onto HyA hydrogels,104 of which the main binding site is α3β1 integrin of the cells; the HyA hydrogels were prepared by crosslinking HyA using adipic dihydrazide. Subsequently, the bioactive peptide PPFLMLLKGSTR was conjugated to crosslinked HyA hydrogels with 1,10-carbonyldiimidazole. Rat BMSCs in the HyA hydrogel scaffolds conjugated with PPFLMLLKGSTR showed better survival and adhesion than the cells in nonmodified HyA hydrogels did.104 Rat BMSCs in HyA hydrogel scaffolds conjugated with PPFLMLLKGSTR were implanted in the transected spinal cord of Sprague Dawley (SD) rats. The transplanted cells were restored in injured spinal cord tissue, and hindlimb motor function was significantly improved with the use of HyA hydrogel scaffolds conjugated with PPFLMLLKGSTR compared to the use of nonmodified HyA hydrogel scaffolds.104 A comparison of the results using other peptide-conjugated HyA hydrogel scaffolds such as HyA hydrogel scaffolds conjugated with RGDSP, IKVAV, YIGSR with and without a joining segment (GG or GGGG) would clarify the advantage of HyA hydrogels conjugated with PPFLMLLKGSTR for the treatment of spinal cord injuries in SD rats.
Chung et al. grafted a cell-adhesive peptide GRGD on a blend film of polyurethane (PU) and PEG.213 The GRGD peptide was activated with the reaction of N-succinimidyl-6-[4′-azido-2′-nitrophenylamino]-hexanoate (SANPAH) (Fig. 14 and 20), which introduces an azide group on the peptide. The SANPAH-GRGD solution was adsorbed on the PU-PEG blend film surface, and subsequently, the PU-PEG blend film surface was irradiated with UV light for photoreaction.213 HUVECs showed better adhesion to the GRGD-grafted PU-PEG blend film surface than to the film without GRGD grafting.
Melkoumian et al. developed polyacrylate surfaces grafted with several bioactive peptides using EDC/NHS chemistry, where these peptides were derived from bone sialoprotein (KGGNGEPRGDTYRAY (BSP-1) and PEO4-NGEPRGDTYRAY (BSP-2)), vitronectin (KGGPQVTRGDVFTMP (VN-1)), fibronectin (GRGDSPK (FN-1) and KGGAVTGRGDSPASS (FN-2)) and laminin (KYGAASIKVAVSADR (LN-1)), which were taken from the literature.94 The peptides BSP-1, BSP-2, VN-1, FN-1 and FN-2 contain the RGD motif, whereas the peptide LN-1 contains the laminin motif IKVAV. BSP-2 has a joint segment of PEO4.
hESC attachment to the polyacrylate surface grafted with BSP-1, BSP-2 and VN-1 was found to be similar to attachment to Matrigel-coated dishes, whereas poor hESC attachment was found on the polyacrylated surface grafted with FN-1, FN-2 and LN-1.94 It should be noted that a high concentration peptide solution is necessary to prepare the grafted polyacrylated surface, such as more than 0.5 mM, which corresponds to 1000 μg mL−1 and 1200 μg mL−1 for BSP-1 and VN-1 solutions, respectively. The concentrations of recombinant vitronectin or laminin-521 solution for coating ECMs are more than two orders of magnitude less, such as 5 or 20 μg mL−1.
hESCs could be cultivated on the polyacrylate surface grafted with BSP-1 and VN-1 in chemically defined medium for over 12 passages with a doubling time of approximately 40 h and a maintained pluripotency, which are results similar to those of hESCs cultured on Matrigel-coated dishes (the gold standard for hPSC culture).94
Although hESCs could not attach to and proliferate on the polyacrylate surface grafted with laminin-derived peptide, better selection of the bioactive peptides derived from laminin, such as those containing the RGD motif, will support hPSC adhesion and proliferation, as reported previously.68,87,88
Peptides can be covalently conjugated on clean glass. In one study, after treating a glass plate with trifluoroacetic acid, the surface was treated with (3-aminopropyl)triethoxysilane to generate an amino segment-grafted surface. Subsequently, the bioactive peptide can be conjugated with amino groups using the reagents 2-(1H-benzotriazol-1-yl)-1,1,3,3-tetramethyluronium hexafluorophosphate (HBTU), 1-hydroxybenzotriazole (HOBt), and N,N-diisopropylethylamine (DIPEA).284 Zamuner et al. prepared glass plates, which were covalently conjugated with a proteolytically stable osteoblast-adhesive peptide, YGKRNTHRFYGKRNTHRF, using this surface reaction method.284
Okano et al. prepared a temperature-responsive cell culture surface containing the cell binding site RGDS,285 which enabled controlled detachment of the cells by reducing the temperature below the lower solution critical temperature (LCST) of the thermoresponsive segments grafted on the surface. In this case, N-isopropylacrylamide and 2-carboxyisopropylacrylamide were grafted onto the TCPS surface using electron beam irradiation. Subsequently, RGDS was bonded to the carboxylic acid of 2-carboxyisopropylacrylamide using a water soluble carbodiimide (1-ethyl-3-(3-dimethylaminopropyl)carbodiimide). When HUVECs were cultured on a poly(N-isopropylacrylamide-co-2-carboxyisopropylacrylamide) surface conjugated with RGDS, HUVECs could be successively detached from the thermoresponsive surface at a lower temperature (20 degrees), where poly-N-isopropylacrylamide contributed to the thermoresponsive site on the cell culture surface.
Becker et al. grafted bioactive peptides onto polyether ketone (PEEK) disks.210 Because PEEK contains a ketone group (Fig. 8), ethylene diamine was conjugated on the PEEK surface using a Schiff base reaction.286–288 Subsequently, diethylene glycol diglycidyl ether (DGDE) (Fig. 14) was reacted with the amino group on PEEK, where the head group of epoxy was reacted with the amino group of the peptide (RGD). In this reaction, the compound 3-(2-pyridyldithio)propionamido-PEG4-NHS ester N-succinimidyl 3-oxo-1-(pyridin-2-yldisulfanyl)-7,10,13,16-tetraoxa-4-azanonadecan-19-oate 3-oxo-1-(pyridin-2-yldisulfanyl)-7,10,13,16-tetraoxa-4-azanonadecan-19-oic acid N-succinimidyl ester (PEG4-SPDP) (Fig. 14) might be used instead of DGDE, and SGRGD is conjugated on the PEEK surface. In this case, a joint segment of (PEG)4 may effectively support the binding of the cells and SGRGD.
Several researchers have used a mussel-inspired immobilization method on material surfaces.201,289,290 Poly-3,4-dihydroxy-L-phenylalanine (L-pDOPA) is a main component of mussel adhesive materials. 3,4-Dihydroxy-L-phenylalanine (L-DOPA) can be polymerized in alkaline conditions, such as at the pH of marine environments, by oxidative conversion of catecholamines to quinones. L-pDOPA can be coated onto biomaterial surfaces in a thin layer. Furthermore, amine, thiol and imidazole groups can be covalently bonded to catechol groups on an L-pDOPA layer. Therefore, Ko et al. prepared a PLGA scaffold where L-pDOPA was coated on PLGA scaffolds by immersing of the scaffolds into L-DOPA and the subsequent spontaneous polymerization of L-DOPA.201 Subsequently, L-pDOPA-coated PLGA scaffolds were immersed in BMP-2 peptide solution, and BMP-2 peptide was conjugated to L-pDOPA-coated PLGA (BMP-2-pDOPA-PLGA) scaffolds by Michael-type addition. hADSCs in BMP-2-pDOPA-PLGA scaffolds showed improved in vitro osteogenic differentiation and in vivo bone formation in critical-sized calvarial bone defects.201
Barati et al. prepared poly(DL-lactide)-conjugated EEGGC,130 which is the nucleating peptide of calcium phosphate, and electrospun poly(DL-lactide) (PLA)-conjugated EEGGC to generate nanofibers for calcium phosphate nucleation and osteogenic differentiation of hBMSCs, where PLA was reacted with acryloyl chloride to generate acrylate-terminated PLA. Subsequently, the EEGGC peptide was conjugated with acrylate-terminated PLA by a Michael addition reaction.
Another method to immobilize peptides on a material surface is to use the avidin–biotin reaction. Wrighton et al. prepared streptavidin-coated PS dishes291 where streptavidin is a 53 kDa protein; therefore, the coated dishes can be prepared by just insertion (coating) of the streptavidin solution into PS dishes. Then, the biotinylated linker solution, such as biotinyl-6-aminohexanoic acid and biotinyl-8-amino-3,6-dioxaoctanoic acid, was injected into the streptavidin-coated PS dishes. Because the head site of the biotinylated linker is a carboxylic acid and will be immobilized on streptavidin-coated PS dishes, the amino group of peptides can be conjugated with the cap carboxylic acid on the biotinylated linker. This reaction for the preparation of peptide-immobilized PS dishes can be done in an aqueous solution.
There are several other methods to graft bioactive peptides onto materials. Kim et al. polymerized glycidyl methacrylate on a surface (in this case, polyurethane acrylate).292 Subsequently, the osteoinductive peptide BMP-2 was added to the polyglycidyl methacrylate (PGM). BMP-2 was conjugated to the PGM surface by the reaction of the epoxy group in PGM and the amine group of BMP-2.
Klim et al. prepared several SAM surfaces consisting of alkanethiol-conjugated peptides to investigate optimal bioactive peptide sequences225 that supported the adhesion and proliferation of hPSCs. They prepared SAMs using 18 different bioactive peptides, which were derived from NCAM (NCAM-1, GGGEVYVVAENQQGKSKA), bone morphogenetic-2 (BMP-1, KIPKASSVPTELSAISTLYL), Dkk-1 (Dkk-1, LSSKMYHTKGQEGSVSLRSSD), phage display (PD-1, ADSQLIHGGLRS; PD-2, MHRMPSFLPTTL), N-cadherin (CAD-1, INPISGQ), occludin (OC-1, GSQIYALCNQFYTPAATGLYVD), E-cadherin (CAD-2, ATYTLFSHAVSSNGNAV), annexin (ANX-1, GGSTVHEILSKLSLEG), combinatorial chemistry (CC-1, GGGKHIFSDDSSE), fibronectin (FN-3, KPHSRN; FN-4, GWQPPRARI; FN-5, GGPEILDVPST), vitronectin (HBP-1, GKKQRFRHRNRKG), laminin (LN-2, GSDPGYIGSR; LN-3, GGIKVAV), BSP (BSP-3, FHRRIKA), and fibronectin/vitronectin (FVN-1, KGRGDS). Among the 18 peptides, only FVN-1 contained RGD.
The SAM surfaces prepared from heparin-binding peptides (HBP-1, BSP-3 and FN-4) could extensively support hESC attachment and proliferation, maintaining pluripotency in mTeSR1 media containing Y-27632 (ROCK inhibitor), whereas the SAM surface prepared with the integrin ligand KGRGDS (FVN-1) could not maintain the pluripotency of hESCs.225 Several hESC lines (DF19-97T, H14, H13, H9) and hiPSCs (IMR-90) were cultured on plates immobilized with the HBP-1 peptide using streptavidin–biotin chemistry in mTeSR1 together with Y-27632. Extensive proliferation of hPSCs was found over 3 months (17 passages), and their pluripotency and normal karyotypes were maintained.225 These cells could differentiate into cells derived from three germ layer lineages after 3 months of culture. The hESCs could also be cultured on the surface immobilized with HBP-1 peptide and the cyclic RGD peptide for two months in mTeSR1 medium without a ROCK inhibitor; and the hESCs maintained their self-renewal characteristics while maintaining pluripotency and normal karyotypes.225 Specific peptide-immobilized plates, which do not contain RGD moieties, can also support hPSC proliferation and pluripotency in a chemically defined medium and are preferable compared to ECM-immobilized plates because of their fully synthetic properties.
In most cases, ECM proteins with high molecular weights can be immobilized on a material surface using a very low concentration ECM protein solution, such as 5–20 μg mL−1, whereas smaller ECM-derived peptides need to be in a solution with a concentration 1–2 orders of magnitude higher for immobilization on a material surface using both the coating method and grafting method. This is likely due to the difference in the binding affinity of stem cells for ECM proteins and ECM-derived peptides. ECM-derived peptides cannot bind to specific integrin receptors because their conformation is too flexible, unlike ECM proteins. However, the improved design of peptide grafting on the surface might reduce the grafting or coating concentration of ECM-derived peptides in the future, which is a topic for future study in the field of peptide design and immobilization (grafting) methods.
ECM-derived peptide-immobilized materials, such as not only 2D culture dishes but also scaffolds, hydrogels, implants and nanofibers, will be used in stem cell culture and differentiation for academic purposes and clinical applications. There will likely be a high clinical demand for improved cell adhesion to implants and scaffolds by ECM protein-derived peptide immobilization. Furthermore, the materials immobilized with ECM protein-derived peptides will be useful for the efficient differentiation of hPSCs into cells with relatively lower adhesion, such as neural cells, cardiomyocytes and β cells, since the cell adhesion of the differentiated cells can be increased.
Footnotes |
† Electronic supplementary information (ESI) available. See DOI: https://doi.org/10.1039/d2tb02601e |
‡ These authors contributed equally to this work. |
This journal is © The Royal Society of Chemistry 2023 |