Open Access Article
This Open Access Article is licensed under a
Creative Commons Attribution 3.0 Unported Licence

Heterologous production of the lantibiotic Ala(0)actagardine in Escherichia coli

Yanxiang Shi , Alejandro Bueno and Wilfred A. van der Donk *
Department of Chemistry and Howard Hughes Medical Institute, University of Illinois at Urbana-Champaign, 600 S Mathews Ave, Urbana, IL 61801, USA. E-mail: vddonk@uiuc.edu; Fax: +1 217 244 8533; Tel: +1 217 244 5360

Received 31st August 2012 , Accepted 19th September 2012

First published on 4th October 2012


Abstract

We report the heterologous production of Ala(0)actagardine in E. coli by co-expression of the substrate peptide GarA and its modification enzymes GarM and GarO. The activity of GarO, a luciferase-like monooxygenase that introduces the unique sulfoxide group of actagardine, was also investigated in vitro.


Lantibiotics are a class of ribosomally synthesized and post-translationally modified peptides.1,2 They are characterized by the thioether-containing linkages lanthionine (Lan) and/or methyllanthionine (MeLan), originating from the dehydration of Ser/Thr residues in a precursor peptide (generically named LanA) followed by intramolecular Michael-type addition of Cys to the dehydrated residues. These dehydrations and cyclizations are catalyzed by modification enzymes that act on the C-terminal core region of the LanA peptide. An N-terminal leader peptide is typically required for the modification of the core peptide (Fig. 1). Nisin, the best characterized lantibiotic, has been used as a food preservative to combat food-borne pathogens for more than forty years without the development of widespread antibiotic resistance.3 As such, lantibiotics are a promising group of compounds4 to battle the continuous rise of antibiotic resistance.5
Structures of actagardine,7 deoxyactagardine B (DAB), NVB302 and Ala(0)-deoxyactagardine B-Lys. The sequence of the leader peptide is MSALAIEKSWKDVDLRDGATSHPAGLGFGELTFEDLREDRTIYA.
Fig. 1 Structures of actagardine,7 deoxyactagardine B (DAB), NVB302 and Ala(0)-deoxyactagardine B-Lys. The sequence of the leader peptide is MSALAIEKSWKDVDLRDGATSHPAGLGFGELTFEDLREDRTIYA.

Actagardine (originally isolated under the name gardimycin)6 is a 19-amino acid globular lantibiotic produced by Actinoplanes garbadinensis ATCC 31049 (Fig. 1).7,8 Ala(0)-actagardine is a natural variant with an additional N-terminal alanine that is produced by Actinoplanes liguriae ATCC 31048.9 Actagardine possesses potent antimicrobial activity against gram-positive pathogens including Clostridium difficile and is stable in simulated gastric fluid.10 Actagardine inhibits cell wall biosynthesis by binding to lipid II,11 and its binding is not antagonized by vancomycin.12 Deoxyactagardine B (DAB) is a structural analogue of actagardine, differing by two residues (V15L and I16V compared with actagardine) and the absence of the sulfoxide group.13 Compound NVB302, a semisynthetic derivative of DAB with a diaminoheptane tail attached to the C-terminus of DAB, has completed Phase I clinical trials for treatment of C. difficile-associated diarrhea.

The biosynthetic gene cluster of actagardine in A. garbadinensis ATCC 31049 was reported in 2009. In the cluster, garA encodes the precursor peptide, and garM encodes a bifunctional lanthionine synthetase that performs both the dehydration and cyclization of the core peptide (Fig. 1). The gene for a monooxygenase GarO is located downstream of garA and garM, and is expected to catalyze the formation of the sulfoxide group in actagardine on the basis of gene disruption studies.14

Actagardine and its derivatives have been produced by fermentation of Actinoplanes sp. or by heterologous expression in Streptomyces lividans.13,14 Based on the recent success in producing lanthionine-containing peptides in E. coli by co-expression of the substrate and corresponding modification enzymes,15–18 we set out to produce Ala(0)actagardine in E. coli. The genes encoding GarA, GarM and GarO were cloned from genomic DNA of A. garbadinensis ATCC 31049. Subsequently, garA and garM were inserted into the pRSFDuet-1 vector as a biscistronic construct (garA/garM/pRSFDuet-1) encoding N-terminally His6-tagged GarA and wild type GarM. Two copies of the garO gene were inserted into the pCDFDuet-1 vector encoding proteins lacking an N-terminal hexahistidine tag.

Co-expression of GarM and His6-tagged GarA using the garA/garM/pRSFDuet-1 vector successfully generated four-fold dehydrated GarA. The peptide was purified by immobilized metal affinity chromatography (IMAC; Ni2+) and reversed-phase high-performance liquid chromatography (RP-HPLC). After lyophilization, 4.2 mg modified GarA was obtained from a 1 L culture. Proteolytic removal of the majority of the leader peptides with trypsin (cleavage after Arg-5 of the leader peptide) followed by treatment with aminopeptidase A8200 to remove residues -4 to -2 generated a product consistent with Ala(0)-deoxyactagardine (Fig. 2A). After incubation with 2-iodoacetamide (IAA), no IAA adducts were detected by matrix-assisted laser desorption ionization (MALDI) mass spectrometry (MS) (Fig. S1, ESI), suggesting that free cysteines were not present in the core peptide.


MALDI-MS spectra of GarA modified by GarM in E. coli and treated with trypsin and aminopeptidase A8200 to remove the leader peptide. (A) Spectrum of Ala(0)-deoxyactagardine, [M + H]+ calculated m/z: 1945.34, observed m/z: 1945.68; (B) spectrum of Ala(0)-DAB-Lys, [M + H]+ calc. m/z: 2073.51, obsv. m/z: 2074.01.
Fig. 2 MALDI-MS spectra of GarA modified by GarM in E. coli and treated with trypsin and aminopeptidase A8200 to remove the leader peptide. (A) Spectrum of Ala(0)-deoxyactagardine, [M + H]+ calculated m/z: 1945.34, observed m/z: 1945.68; (B) spectrum of Ala(0)-DAB-Lys, [M + H]+ calc. m/z: 2073.51, obsv. m/z: 2074.01.

Ala(0)-deoxyactagardine (Ala(0)-DA) thus produced displayed low solubility. NVB302, which is under clinical development, contains a C-terminal 1,7-diaminoheptane tail, which increases solubility and bioactivity compared with deoxyactagardine.19 In order to produce a structure similar to NVB302, we substituted Val15 and Ile16 in GarA with Leu and Val, respectively, and introduced a lysine residue at its C-terminus, forming GarA-V15L/I16V/19insK (Fig. 1) to similarly increase the solubility of Ala(0)-DA produced in E. coli. The dehydration and cyclization of this mutant GarA by GarM were not affected by these mutations or by the addition of the C-terminal lysine as confirmed by MALDI MS after proteolytic cleavage (Fig. 2B). The compound produced was termed Ala(0)-DAB-Lys (Fig. 1).

To confirm that the product had the correct ring topology, it was analyzed by tandem MS indicating a globular structure as no fragments were generated from the C-terminal fourteen amino acid region (Fig. S2, ESI). Furthermore, Ala(0)-DAB-Lys displayed antimicrobial activity against Bacillus subtilis W23, Microccoccus luteus 4698 (Fig. 3 and Fig. S3, ESI), and Enterococcus faecalis 29212. The MIC of Ala(0)-DAB-Lys against E. faecalis was 7.3 μM compared to 4.2 μM reported for deoxyactagardine.14 Thus, the addition of the C-terminal lysine largely maintained the antimicrobial activity of Ala(0)-deoxyactagardine, while significantly increasing solubility.


Antimicrobial assays of Ala(0)-DAB-Lys modified in E. coli. (1) Nisin, (2) Ala(0)-DAB-Lys from GarA/GarM coexpression in E. coli, (3) negative control containing buffer and proteinases. The applied samples in (1) and (2) consisted of 20 μL of 100 μM stock solutions.
Fig. 3 Antimicrobial assays of Ala(0)-DAB-Lys modified in E. coli. (1) Nisin, (2) Ala(0)-DAB-Lys from GarA/GarM coexpression in E. coli, (3) negative control containing buffer and proteinases. The applied samples in (1) and (2) consisted of 20 μL of 100 μM stock solutions.

Deoxyactagardine is less active than actagardine against some bacterial strains with a two-fold increased MIC for inhibition of the growth of M. luteus 4698.14 In an attempt to produce sulfoxide-containing analogs, co-expression of the monooxygenase GarO was pursued. Two systems were evaluated in which either the garA/garM/pRSFDuet-1 plasmid was used in combination with a pCDFDuet-1 vector containing two copies of garO or the garO gene was inserted into the garA/garM/pRSFDuet-1 plasmid (see ESI). His6-tagged GarA was purified by IMAC followed by C8 solid phase extraction (SPE). The purified product was incubated with trypsin and aminopeptidase to remove the leader peptide and the product was analyzed by MALDI-MS. For both approaches, the mass of the resulting fourfold dehydrated core peptide was increased by 16 Da (Fig. 4A and Fig. S4, ESI), consistent with the formation of one sulfoxide group. Unfortunately, when the same experiments were performed with GarA-V15L/I16V/19insK, the GarO-mediated oxidation was incomplete (Fig. S5, ESI), suggesting that the additional C-terminal Lys interferes with efficient oxidation.


MALDI-MS spectra of GarA modified by GarM and GarO. (A) Spectrum of GarA co-expressed with GarM and GarO in E. coli and treated with trypsin, M indicates GarM-modified GarA treated with trypsin, [M + O + Na]+ calc. m/z: 2431.06, obs. m/z: 2431.45; (B) product of incubation of GarA-V15L/I16V/19insK with GarO in vitro and subsequent trypsin digest; [M + O + Na]+ calc. m/z: 2559.23, obs. m/z: 2559.55; (C) product of incubation of purified Ala(0)-DAB-Lys with GarO in vitro, M indicates Ala(0)-DAB-Lys, [M + O + Na]+ calc. m/z: 2111.49, obs. m/z: 2111.77.
Fig. 4 MALDI-MS spectra of GarA modified by GarM and GarO. (A) Spectrum of GarA co-expressed with GarM and GarO in E. coli and treated with trypsin, M indicates GarM-modified GarA treated with trypsin, [M + O + Na]+ calc. m/z: 2431.06, obs. m/z: 2431.45; (B) product of incubation of GarA-V15L/I16V/19insK with GarO in vitro and subsequent trypsin digest; [M + O + Na]+ calc. m/z: 2559.23, obs. m/z: 2559.55; (C) product of incubation of purified Ala(0)-DAB-Lys with GarO in vitro, M indicates Ala(0)-DAB-Lys, [M + O + Na]+ calc. m/z: 2111.49, obs. m/z: 2111.77.

Actagardine is the only lantibiotic containing a sulfoxide group. To investigate the GarO enzymatic activity in vitro, garO was cloned into a pET28b vector. The protein was expressed in E. coli with an N-terminal His6-tag, and was purified by IMAC. His6-GarO behaved as a monomer in solution as determined by analytical gel filtration chromatography (Fig. S6, ESI). Sequence analysis suggests that GarO is a luciferase-like monooxygenase that possesses a typical binding domain for flavin mononucleotide (FMN). Previous studies on luciferase-like enzymes20,21 have shown that reduced FMN reacts with molecular oxygen, forming a flavin-hydroperoxide, which is followed by transfer of an oxygen atom to the substrate. NAD(P)H then commonly reduces the oxidized flavin back to its reduced form. We incubated GarM-modified GarA and GarA-V15L/I16V/19insK with purified GarO, FMN, and NADH, followed by proteolytic removal of the leader peptide as described above. MALDI analysis showed the formation of a molecular ion consistent with a single oxidation in the core peptide (Fig. 4B). Substitution of NADH with NADPH resulted in abolishment of the GarO activity.

The dehydration and cyclization reactions involved in lantibiotic biosynthesis require the presence of the leader peptide, but other tailoring-type transformations such as hydroxylation16 and oxidative decarboxylation22 do not require the leader peptide to be attached. To determine whether oxidation by GarO required the leader peptide, the enzyme was incubated for 8 h with purified Ala(0)-DAB-Lys, FMN, and NADH. The major product was a peptide with m/z of +16 Da (Fig. 4C). The addition of 16 Da occurs in the region of the three intertwined-rings of the product as shown by tandem mass spectrometry (Fig. S2, ESI), consistent with the reported structure of actagardine. Thus, the leader peptide is not required for GarO catalysis. A peak corresponding to the addition of three oxygen atoms was also observed in the product of in vitro GarO modification. This product is likely the result of uncoupling of the formation of the flavin peroxide and the oxygen transfer to the substrate, resulting in the formation of hydrogen peroxide or superoxide, which are known general side products of in vitro reactions with flavin-dependent monooxygenases.23 Hydrogen peroxide formation in turn results in non-enzymatic oxidation of the thioether rings.

In summary, by coexpression of the GarA precursor peptide and its modification enzyme GarM in E. coli, dehydrated and cyclized Ala(0)-deoxyactagardine was produced after proteolytic treatment. Introduction of a lysine residue at the C-terminus of Ala(0)-deoxyactagardine B generated a derivative with increased solubility and comparable bioactivity. This methodology may present an alternative route to actagardine analogs. The activity of GarO monooxygenase in the actagardine biosynthesis cluster was demonstrated in E. coli and in vitro. The enzyme was active in the absence of the GarA leader peptide.

This work was supported by the National Institutes of Health (GM58822 to W.A.V.).

Notes and references

  1. P. J. Knerr and W. A. van der Donk, Annu. Rev. Biochem., 2012, 81, 479 CrossRef CAS.
  2. G. Bierbaum and H. G. Sahl, Curr. Pharm. Biotechnol., 2009, 10, 2 CAS.
  3. J. Lubelski, R. Rink, R. Khusainov, G. N. Moll and O. P. Kuipers, Cell. Mol. Life Sci., 2008, 65, 455 CrossRef CAS.
  4. P. D. Cotter, C. Hill and R. P. Ross, Curr. Protein Pept. Sci., 2005, 6, 61 CrossRef CAS.
  5. M. A. Fischbach and C. T. Walsh, Science, 2009, 325, 1089 CrossRef CAS.
  6. S. Somma, W. Merati and F. Parenti, Antimicrob. Agents Chemother., 1977, 11, 396 CrossRef CAS.
  7. N. Zimmermann, J. W. Metzger and G. Jung, Eur. J. Biochem., 1995, 228, 786 CrossRef CAS.
  8. A. Malabarba, M. Landi, R. Pallanza and B. Cavalleri, J. Antibiot., 1985, 38, 1506 CrossRef CAS.
  9. L. Vértesy, W. Aretz, A. Bonnefoy, E. Ehlers, M. Kurz, A. Markus, M. Schiell, M. Vogel, J. Wink and H. Kogler, J. Antibiot., 1999, 52, 730 CrossRef.
  10. S. Donadio, S. Maffioli, P. Monciardini, M. Sosio and D. Jabes, Appl. Microbiol. Biotechnol., 2010, 88, 1261 CrossRef CAS.
  11. Y. Héchard and H. G. Sahl, Biochimie, 2002, 84, 545 CrossRef.
  12. H. Brötz, G. Bierbaum, K. Leopold, P. E. Reynolds and H. G. Sahl, Antimicrob. Agents Chemother., 1998, 42, 154 Search PubMed.
  13. S. Boakes, A. N. Appleyard, J. Cortes and M. J. Dawson, J. Antibiot., 2010, 63, 351 CrossRef CAS.
  14. S. Boakes, J. Cortes, A. N. Appleyard, B. A. M. Rudd and M. J. Dawson, Mol. Microbiol., 2009, 72, 1126 CrossRef CAS.
  15. Y. Shi, X. Yang, N. Garg and W. A. van der Donk, J. Am. Chem. Soc., 2011, 133, 2338 CrossRef CAS.
  16. A. Ökesli, L. E. Cooper, E. J. Fogle and W. A. van der Donk, J. Am. Chem. Soc., 2011, 133, 13753 CrossRef.
  17. N. Garg, W. Tang, Y. Goto and W. A. van der Donk, Proc. Natl. Acad. Sci. U. S. A., 2012, 109, 5241 CrossRef CAS.
  18. W. Tang and W. A. van der Donk, Biochemistry, 2012, 51, 4271 CrossRef CAS.
  19. M. J. Dawson, A. N. Appleyard, J. Cortes Bargallo and S. N. Wadman, Actagardine Derivatives, and Pharmaceutical Use Thereof, WO/2011/095769, 2011 Search PubMed.
  20. W. J. H. van Berkel, N. M. Kamerbeek and M. W. Fraaije, J. Biotechnol., 2006, 124, 670 CrossRef CAS.
  21. R. Boden, E. Borodina, A. P. Wood, D. P. Kelly, J. C. Murrell and H. Schaefer, J. Bacteriol., 2011, 193, 1250 CrossRef CAS.
  22. T. Kupke, C. Kempter, G. Jung and F. Götz, J. Biol. Chem., 1995, 270, 11282 CrossRef CAS.
  23. S. K. Krueger and D. E. Williams, Pharmacol. Ther., 2005, 106, 357 CrossRef CAS.

Footnote

Electronic supplementary information (ESI) available: General experimental procedures, mass spectra, and bioassay results. See DOI: 10.1039/c2cc36336d

This journal is © The Royal Society of Chemistry 2012
Click here to see how this site uses Cookies. View our privacy policy here.